KEGG   Mycobacterium sp. JS623: Mycsm_06302Help
Entry
Mycsm_06302       CDS       T02423                                 

Definition
(GenBank) PAS domain S-box
Organism
msa  Mycobacterium sp. JS623
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ANTAR PAS_3 PAS_9
Motif
Other DBs
NCBI-ProteinID: AGB26455
UniProt: L0J4H6
Position
complement(6261763..6262392)
Genome map
AA seq 209 aa AA seqDB search
MDAEQSPPEWPAAGSFRYHAQEDRWEWSDEVAAMHGYQPGTVNPTTELVLSHKHPDDKPT
VAQLIDQVRRLGIPFSSRHRIIDTAGNVHVVVVVGDRWTDGDGEVIGTTGFYVDVTEDFD
ADVQRSLNDVVATIAARRATINQAIGMLMLAYGVTAEKGFAMLAQRSQQTNVKLRELAAQ
FVKEAAGAPLQDTARIDEILATVHERLPH
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atcgacgcggagcaatcgccgccggaatggccggcagcgggaagtttcagataccacgcc
caggaggaccgttgggagtggtccgacgaggtggccgcgatgcacggctatcaaccgggg
accgtcaacccgacgaccgaactcgtgctgtcgcacaaacatcccgacgacaagccgacg
gtggcacagctgatcgatcaggtccggcgcctcggcatcccgttctccagcaggcaccgc
atcatcgacacggcaggcaacgtccacgtggtcgtcgtggtcggcgaccggtggaccgac
ggcgacggcgaggtgatcggcacgacgggcttctacgtcgatgtcaccgaagacttcgac
gccgacgtgcagcgctcgctcaacgatgtggtggcgacgatcgctgcgcgcagggccacg
atcaaccaggccatcggcatgctgatgctggcctatggggtgaccgccgagaaggggttc
gccatgctggcccagcgctcacaacagacgaacgtcaagctgcgcgagctggccgctcag
ttcgtcaaggaggcggccggcgcaccgttgcaggacacggcgcgcatcgacgagatcctg
gccaccgtccacgagcgcctgccccactag

DBGET integrated database retrieval system