KEGG   Mycobacterium sp. JS623: Mycsm_06304Help
Entry
Mycsm_06304       CDS       T02423                                 

Definition
(GenBank) ABC-type multidrug transport system, ATPase component
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
msa  Mycobacterium sp. JS623
Module
msa_M00254  ABC-2 type transport system
Brite
KEGG Orthology (KO) [BR:msa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:msa02000]
    Mycsm_06304
Transporters [BR:msa02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   ABC-2 type transporter [MD:M00254] [OT]
    Mycsm_06304
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_30 AAA_16 MutS_V AAA_23 AAA_29 ATP_bind_1 MeaB AAA_27 AAA_22 SRP54 AAA_5 AAA TsaE AAA_14 AAA_18 AAA_7
Motif
Other DBs
NCBI-ProteinID: AGB26457
UniProt: L0J760
Position
6262926..6263762
Genome map
AA seq 278 aa AA seqDB search
MTLAIDCAHLTHRYGNFTAVEDFSLQVRCGETVGLLGPNGAGKTTVVRVLTTLTPVQSGQ
VAIFSLDSRSHTMDIRHNIGYVPQQLSIESALTGRQNVELFARLYDVPHRQRADRVDEAL
GAMQLLDVADGLAATYSGGMVRRLELAQALVNRPSLLILDEPTVGLDPIARDSVWAQVGR
MQQEYGMTVLLTTHYMAEADALCDRVALMHHGRLQAIGSPAELKRAVSAQADVAADEVPE
TTLEDVFRHYAGSDLGEDTSQAGLRAVRNSRRTARRVS
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgactcttgcgatcgattgtgcgcacctgactcaccgctacggcaatttcaccgctgtc
gaggacttcagcctgcaggtgcggtgcggagagactgtcggcctgctcggccccaacggt
gcaggaaagacgacggtggtgcgcgtgctgaccaccctgaccccggtgcagagtggccag
gtagccatcttcagccttgactcgcgaagccacaccatggacatcaggcacaacatcggc
tatgtgccgcaacagctttcgattgagtcggcgttgacgggcaggcagaacgtcgagctg
ttcgcgcgactctacgacgtgccgcaccgccagcgggccgatcgcgtcgacgaggcactg
ggtgcgatgcagctgctcgacgtcgccgacggcctggcggcgacgtactccggcggcatg
gtgcgaaggctggagttggcgcaggcgttggtcaaccggccgtcgctgctgattctcgac
gagccgacggtcggcctggatcccattgcgcgcgacagtgtttgggcccaggtgggccgc
atgcagcaggagtacggcatgacagtgctgctcaccacccattacatggccgaggccgac
gcactgtgtgaccgggtggcgctgatgcatcacggtcgattgcaggccatcgggtcgcct
gcagagttgaagcgagccgtctccgctcaggcagatgtcgccgccgacgaggttccggaa
acgacgctggaggacgtcttccggcactacgcgggttcggatctgggcgaggatacgtcg
caggccgggttgcgcgcggtccgcaacagcaggaggacggcgcgtcgtgtcagttga

DBGET integrated database retrieval system