KEGG   Mycobacterium sp. JS623: Mycsm_06305Help
Entry
Mycsm_06305       CDS       T02423                                 

Definition
(GenBank) ABC-type multidrug transport system, permease component
  KO
K01992  ABC-2 type transport system permease protein
Organism
msa  Mycobacterium sp. JS623
Module
msa_M00254  ABC-2 type transport system
Brite
KEGG Orthology (KO) [BR:msa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:msa02000]
    Mycsm_06305
Transporters [BR:msa02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   ABC-2 type transporter [MD:M00254] [OT]
    Mycsm_06305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC2_membrane ABC2_membrane_3 ABC2_membrane_6
Motif
Other DBs
NCBI-ProteinID: AGB26458
UniProt: L0J6F4
Position
6263752..6264582
Genome map
AA seq 276 aa AA seqDB search
MSVEQNLEGPDVRIVRAPHGWRRVRGMAMRMGAFAIVELQKLRHDRTELLTRMVQPALWL
LIFGQTFSRLRVIDTGHVPYLAFLAPGIIAQSALFISIFYGIQIIWDRDAGILAKLMVTP
APSSALITGKSFAAGVRSVVQVIGVLALAYLLGVHMTVNPLKILGAMGVVMLGAAFFACL
SMTLAGLVQNRDRLMGIGQAITMPLFFASNALYPVDVMPQWLRWLSAVNPLSYEVNALRG
LLIGTPTNGWLDVAVLVVAAVAGIAMASALLRRLVR
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
gtgtcagttgagcagaacctagaaggcccagacgttcggatcgtacgcgcgccgcacggc
tggcgccgggtccgcggaatggccatgcggatgggcgctttcgcgatcgtagaactgcag
aagttgcggcacgatcgcaccgaattgctcaccaggatggtgcagcccgcgctgtggctg
ctgatcttcgggcagacattttcccggctgcgcgtcatcgacaccggccatgtgccttac
ctggcgttcctggcgccgggcatcatcgcgcagtcggcgcttttcatttcgatcttctac
ggcatccaaatcatctgggaccgcgatgcgggcatcctcgcgaagttgatggtgacaccg
gccccgtcgtcggcgctgatcaccggtaagtccttcgcggcgggtgtgcggtcggtggtg
caagtcatcggcgtgctggcgttggcgtatctcctcggcgtgcacatgaccgtcaatccg
ctgaaaatccttggcgcaatgggcgttgtgatgctcggagcggcgtttttcgcctgcctc
tcgatgacgctggccgggctggtgcaaaacagggaccggctgatgggcatcgggcaggcc
atcaccatgccgttgttcttcgcgtcgaacgcgctgtacccggtcgacgtgatgccgcaa
tggctgcgctggctgtcggcggtcaacccgctcagctatgaagtcaacgcgctgcgcgga
ctgctgatcggcacgccgacgaacggttggctcgacgtcgctgtgctggtagtcgcggcg
gtcgcgggcatcgcaatggcctcggcgttgttgcgacggctggtgcgctaa

DBGET integrated database retrieval system