KEGG   Mycobacterium sp. JS623: Mycsm_06306Help
Entry
Mycsm_06306       CDS       T02423                                 

Definition
(GenBank) PMT family glycosyltransferase, 4-amino-4-deoxy-L-arabinose transferase
Organism
msa  Mycobacterium sp. JS623
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PMT_2
Motif
Other DBs
NCBI-ProteinID: AGB26459
UniProt: L0J595
Position
complement(6264584..6266512)
Genome map
AA seq 642 aa AA seqDB search
MSSPPLLDGPETQAPPADDADRPRPTRATAITWDRVGLAVLLVGTAVIYLWNITINGMGN
QFYAAAAQAGSKNWEALLFGSLDPHNFITVDKPPVSQWVMGLSGQIFGFSSASMMIPQAL
MAVASVALLYAAVTRISGPRVGLLAGAVLALTPVAALMFRFNNPDAVMVLLMTAAAYCTV
RAVQQASPKWLAWAAVALGFAFLAKMLEGLMVAPALAAAYLIAAPTTLRARLRHIGVAAV
AFVMSAGWFVVLTLLWPASSRPYIAGSTDNNFMNLVLGYNGFARVLGKNHMDFGTPDNVV
GTSAGAQLHNGGHGGFAFGNQSQGLPRLVSGEFGFEIGWLVPAALLATVMVVLSRGRAPR
TDLTRAAAIVFGGWLIVDGLVLSFMHGTIHAYYCLSIAPPVAAMFAIGVHELWQRREKWL
YRAGLAVLLGGTGAWAWVVLGRNASWLPALRWTILALAVLAVVALLVPWTYRADRRFAFG
ALGIGLVAALAGPAVYAVVTIGQPHEGGGPSVGPADASRQGHFGFGQNKDNPALDTMLKN
TNTEWSAAISRSSSAAGLELSTDTAVMAIGGFSGTDPVPTLSEFKTDVAQHKVAYYVVVN
DHGHGPGWGNSRGHADIAKWVAATFESTSVGDATVYDLSTPK
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
gtgagttcaccaccacttttggacggcccagagacgcaagcaccgcccgctgacgacgca
gaccggccgcggcccacccgagcgaccgcgatcacgtgggaccgggtgggcctcgccgtg
ttgttggtcggcacagcggtcatctacctgtggaacatcaccatcaacgggatgggcaac
cagttctatgccgctgcggcgcaagcgggttcgaagaattgggaagcgttgctgttcggc
tcgctcgacccgcacaacttcatcaccgtcgacaaacctcccgtctcacaatgggtgatg
ggactgtccggccagatattcggcttcagcagcgcgagcatgatgatcccgcaggcgttg
atggcggtcgcctccgtcgccttgttgtacgccgcggtgactcgcatcagcggcccccgc
gtcgggttgcttgcgggcgcagtgctggcgctgacgccggtggccgcgttgatgtttcgg
ttcaacaaccccgacgcggtgatggtgctgctgatgaccgctgcggcgtactgcaccgtg
cgcgccgtgcaacaggcgagcccgaagtggttggcatgggcggcggtggcactgggattc
gcattcctggccaagatgctcgaagggctgatggtggccccggcactcgccgctgcctac
ctgatcgcggcgccgacgacgttgcgtgcccggctgcgacacatcggcgtggcagcggtc
gcattcgtcatgtcggcgggctggttcgtggtgctgacgctgctgtggcctgcatcctcg
cggccgtatatcgcaggctcgaccgacaacaacttcatgaatctggtgttgggctacaac
ggttttgcccgcgtgctcggaaagaatcacatggacttcggtacgcccgacaacgtcgtt
ggtacctcggcgggtgcgcaactgcacaacggtggacatggcggcttcgcattcggcaat
caatcccaggggttgccgcggttggtcagcggcgaattcggtttcgagatcggctggctg
gtgcccgcggcgttgttggcgaccgttatggtcgtgctctcccgcggacgtgccccgcga
acggatctgacccgggccgccgcgattgtgttcggcggctggctgatcgtggacgggctg
gtactgagcttcatgcacggcacgatccacgcgtactactgcctgtcgatcgcccctccc
gtggcagcgatgttcgccatcggtgtgcatgagctctggcagcggcgagaaaagtggttg
taccgagccggtttggctgtgctgcttggcgggacgggcgcgtgggcatgggtcgtcctc
ggccggaacgcaagctggctgcccgccctgcgctggacgatcctggcgctggcagtcctc
gcggtggtcgcgctgctcgtcccgtggacttaccgggccgatcggcgctttgccttcggc
gcgttgggcattggattggtcgcggcgctcgccggtccggccgtctatgcggtcgtcacg
atcggtcagccgcatgaaggcggcggaccatcggtcgggcccgccgacgcgtcgcggcag
ggtcactttggcttcggccagaacaaggacaaccctgccctcgacacgatgctgaagaac
accaacaccgaatggtcggccgcgatcagccgctcgtcgagtgccgctggcctcgaattg
tccacggacacagcggtgatggcgatcggcggcttctccggaactgacccggtaccgacg
ctgagcgagttcaagaccgacgtcgcgcagcacaaggtggcgtactacgtcgtcgtgaac
gaccacggccacggacccggctggggcaacagccgtggtcacgccgacattgcgaaatgg
gtcgcggcgacgtttgaatcgacgtcggttggggatgcgacggtgtatgacctatcgaca
ccgaagtga

DBGET integrated database retrieval system