KEGG   Mycobacterium sp. JS623: Mycsm_06308Help
Entry
Mycsm_06308       CDS       T02423                                 

Definition
(GenBank) monoamine oxidase
  KO
K00274  monoamine oxidase [EC:1.4.3.4]
Organism
msa  Mycobacterium sp. JS623
Pathway
msa00260  Glycine, serine and threonine metabolism
msa00330  Arginine and proline metabolism
msa00340  Histidine metabolism
msa00350  Tyrosine metabolism
msa00360  Phenylalanine metabolism
msa00380  Tryptophan metabolism
msa01100  Metabolic pathways
msa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:msa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mycsm_06308
   00330 Arginine and proline metabolism
    Mycsm_06308
   00340 Histidine metabolism
    Mycsm_06308
   00350 Tyrosine metabolism
    Mycsm_06308
   00360 Phenylalanine metabolism
    Mycsm_06308
   00380 Tryptophan metabolism
    Mycsm_06308
Enzymes [BR:msa01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     Mycsm_06308
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO FAD_oxidored FAD_binding_2 Pyr_redox_2 Pyr_redox_3 HI0933_like GIDA Pyr_redox Lycopene_cycl FAD_binding_3 NAD_binding_9 Thi4
Motif
Other DBs
NCBI-ProteinID: AGB26461
UniProt: L0J808
Position
complement(6267064..6268437)
Genome map
AA seq 457 aa AA seqDB search
MAIMTDVNYCVVGAGFAGLAAALRLKQSGESVALLEARDRVGGRTFTEVRDDGVWIDHGG
AWIGPGQDRIKAVMSEYGVRSYKQYLDGKAMMIIDGRQYRYSGTIPWSLSPWASANLGAV
FLELGQMSKSIPLEAPWEAKHAEKWDQITLAKWLSSNTVSKAAHDLLETALAGCYTSAAS
EVSMLFALYQMASGGGPGFLLGVKDGAQDSRIIGGMGAVYRPMAAEIGDSLHLLQPVRRI
DQDADGVTVRSDEMTVRARRVIVAVPIAIASQIIYEPMLPVDRSFLHQRMPSGAIYKINI
VYDEPFWRHDGLSGQSAAPGSPATVTIDASTDAERPGVLCVIVEGPIARQIGTLDADDRR
RTILAELVGRFGDKAASPVDYIEQCWTTERYSGGGMLSHAPPGVLTEFGHALRTPCGRIH
WAGTESSAVMCGWVDGAVRSGERAATEVMQRETVAVG
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggcaattatgacagacgttaattattgcgtagttggggcgggattcgctgggctcgcg
gccgcattgcggctcaagcagtccggcgaatcggtggcgctgctggaggccagggatcgg
gtcggtggccggacatttaccgaggtcagggacgatggcgtgtggattgaccacggcggc
gcctggatcgggccggggcaggaccggatcaaggcggtgatgagcgagtacggcgtacgg
agttacaagcagtacctcgacggcaaagccatgatgatcatcgacggtcggcaatatcgc
tactcgggcactattccgtggtcattgagtccgtgggcgtcggccaacctcggcgccgtg
ttcttagaactcgggcagatgtcgaagtcgatcccgctcgaggcgccgtgggaagcgaag
cacgcggagaagtgggaccagatcacgctggccaagtggttgagctccaacacggtgtcc
aaggcagcgcacgacctgctcgagacagcgctggccggctgctacacatcggccgcctcg
gaggtctcgatgctattcgcgctgtaccagatggcctcggggggcgggcccggctttctg
ctcggcgtcaaagacggggcgcaggattcccgaatcatcggcggcatgggtgcggtgtat
cggccgatggccgccgagatcggtgactcgctgcacctgttacagccggtgcgccgcatt
gatcaggacgccgacggtgtgaccgtccgatccgacgagatgaccgtccgggcacgcagg
gtcatcgtcgcggtgccgattgcgattgccagccaaatcatttatgagccaatgcttccc
gtcgatcggtccttcctgcatcagcgcatgccgagcggggcgatctacaagatcaacatc
gtctacgacgagccgttctggcgccacgacgggttgtccggtcagtcggcggctcccggc
tcgcctgcgacggtcaccatcgacgcgtcgactgacgcggagcgtccaggcgtcctgtgc
gtgatcgtcgagggcccgatagcgcggcagatcggaaccctcgatgcggacgaccgcagg
cgaacgatcctggccgagctcgtcgggcgcttcggcgacaaggccgcgtcgcccgtggac
tacatcgagcaatgctggacgaccgagcgctactccgggggcggcatgctcagccacgcc
cctcccggcgtgctgaccgagttcggacacgcgttgcgcacaccgtgcggtcgaattcac
tgggcgggcaccgagagttcggcggtcatgtgcggatgggtcgacggcgcagtccgttcg
ggtgaacgcgccgcgaccgaggtcatgcaacgggaaacagtcgcggtgggttga

DBGET integrated database retrieval system