KEGG   Mycobacterium sp. JS623: Mycsm_06340Help
Entry
Mycsm_06340       CDS       T02423                                 

Definition
(GenBank) PAS domain S-box
Organism
msa  Mycobacterium sp. JS623
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SpoIIE HATPase_c_2 RsbU_N PAS_9 PAS_8 PAS PAS_3 PAS_4
Motif
Other DBs
NCBI-ProteinID: AGB26493
UniProt: L0J6I8
Position
6298185..6300374
Genome map
AA seq 729 aa AA seqDB search
MTGSETNAEFHASYTAALSAYLDDQSEDTLAVGHELGRRALANQISILEIIENHARLTAG
EDSAVALQFLLQTLAALDVATRGFIDGTKRYEQQRTRADNLADRDEFRTALVNSLQEGFF
VSDSSGAVIEVNDAFADITGYGADGLPYAWQHPWMADDAGDRLARLLAQGTLEAEAPIRH
RDGHTVWVAMSVNAVTSPGSHDARGTYVGTIRDITAARAAAERERAVAQLATAVSVAKSI
REVLSAMLDECRTALGVRQVAAIAWPTGEHVDPAVHLAGTPATVTWYDLEPPLRRSLDDA
RAWLPLSVETIGWTTAFDNAHGIVATLTRDLTLWLEFDAPRRVSAEDRQLVAALVGHLSL
AMQHVRQFELARDTSLTLQRAMLAPTELPPGFAVRYEPAVSPLEIGGDWYDVLPVGDDRI
GIIVGDCVGRGLAAAAVMGQLRSSARALLLTGASPATLLEQLDSVAAFIPDAFCTTVFVA
ILDARSETLSYSSAGHVPAVLANGAPQPQLLTDARSVPLAVHRDEPRPQATATLTGGSTL
LLYTDGLVERRGEPIDAGIAHVADVLVQTTEMPVDTVADAMLDELAPALGYDDDVAIVLY
RHPGPALVIEIDAIPARLTDVRHQLIAWLRGAGVPEMQAADIVLVVNEACSNSAEHAYRG
QDPGPMRVEGAVDDQHIHIRVADSGSWKTPPADPGTRGRGLLLMRTLSEAVDLEGTAHGT
TVGMRFAVG
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgaccggctcggagaccaacgcggagttccacgcctcctacaccgccgcgctgagcgcc
tatctcgatgaccaaagcgaggacaccctcgcggtcggccacgagctcggtcgccgcgcg
ctggccaaccagatcagcatcctcgaaatcatcgaaaaccacgcgcggctgacggccggc
gaggactcggcggtcgcgctgcagtttctgctgcagacgctggcggcactggacgtcgcg
acgcgcggattcatcgatggcacaaagcgatacgaacaacagcggacccgcgccgacaat
ctggccgaccgcgacgagttccgcaccgcactggtgaactctctgcaggagggcttcttc
gtttccgacagcagcggggcggtcatcgaggtcaacgatgcgttcgccgacatcaccggc
tacggggccgacggtctgccatacgcgtggcaacacccgtggatggccgacgacgccggc
gatcgactggcgcggctgctcgcgcaaggcacgctggaggccgaggcgccgatccggcac
cgcgacggccacaccgtatgggtggcgatgagcgtcaacgcggtcacctcgccgggtagc
cacgacgccaggggcacctacgtcgggactattcgcgacatcaccgccgcgcgcgccgcg
gccgaacgggagcgcgccgtcgcccagctcgcaacggcggtcagcgtcgcgaagagcatc
cgcgaggtgctgtcggccatgctcgacgagtgccgcaccgcgctgggggtgcggcaggta
gccgccatcgcgtggccgacgggcgagcacgtagacccggccgtccacctggcaggcacg
cccgcgacggtgacctggtacgacctcgagccgccgctgcggcggtcgctcgacgacgcc
cgcgcctggcttcccttatcggtcgaaaccatcggctggacaacggcattcgacaatgcg
catggcatcgtggccactctgacgcgcgacctcaccctgtggctcgaattcgatgctccc
cgcagggtcagcgcggaggaccggcaactggtcgccgcgctcgtcggacacctcagcctg
gcgatgcagcatgttcgccaattcgaactcgcccgcgacacgtcgctgacgctgcagcgg
gccatgcttgcgccgacggaactgccgcccggcttcgcggtgcgctacgagccggcggtg
tcaccgctggaaatcggcggcgactggtatgacgtgctgcccgttggcgacgaccggatc
ggcatcatcgtcggcgactgcgtcggtcgcgggctggccgctgcggcagtgatgggtcag
ctgcgcagctcggcccgggcgctgctgctcaccggcgcatcgcccgcgacgttgcttgaa
cagctcgactcggtcgcggcgttcattccagatgcgttctgcaccaccgtctttgtcgcc
attctcgatgcccgatccgaaacgttgtcctacagcagtgctggacacgttcctgcggta
ctcgccaacggcgcgccgcagccgcagttgttgacggatgcgcggtcagtgccgctggcc
gtgcaccgagacgaacctcgcccgcaagccaccgcgacactgaccggcggatcgaccctg
ctgctctacaccgacgggctggtcgagcggcgcggcgaaccgatcgacgccggcatcgct
cacgtcgccgacgtcttggtgcagacgacggagatgcccgtcgacacggtggccgacgcg
atgctggacgaactggcgccggcgctgggctatgacgacgacgtcgcgatcgtgctttac
cgccatccgggcccggcgctcgtcattgaaatcgacgcgattccagcacgattgaccgat
gtccggcatcagctcattgcgtggctccgcggcgcgggagtgcccgagatgcaggccgcg
gacattgtgctggtggtcaacgaggcgtgcagcaacagcgccgagcacgcctaccgcgga
caggatccgggcccgatgcgggtggagggggcggttgacgatcagcacatccacattcgg
gtcgccgactcgggctcgtggaagacaccgcccgccgaccccggcaccaggggcagggga
ttgctgctgatgcggacgctcagcgaggcggttgacctagagggaactgcgcacggcacc
accgtcggcatgcggttcgcggtcggatag

DBGET integrated database retrieval system