KEGG   Mycobacterium sp. JS623: Mycsm_06343Help
Entry
Mycsm_06343       CDS       T02423                                 

Definition
(GenBank) response regulator with putative antiterminator output domain
Organism
msa  Mycobacterium sp. JS623
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ANTAR Autophagy_act_C
Motif
Other DBs
NCBI-ProteinID: AGB26495
UniProt: L0J4L0
Position
6301276..6302076
Genome map
AA seq 266 aa AA seqDB search
MAPTHFQPRQHPQLMALLHRILERIQSDHLDAVGLAITVHDKRAGEVPSVLAAIGVGADI
AEAQLAGIGGPVPDAHAYQVPVLSLDLWTDDRWPGLTVATMNDRAPQHESIWEQVHGAAA
VPGVWADDATVVVCCTLSQPAGAATVASLINYEQLISAALITTAAENASAIADIITVLQS
RGAIEQAKGALMGLVRCDADHAWQMLRRGSQEFNVKLRELAVALLEHISGAPAEQPDTGT
PITPDERTREAARLMWAALSEAPLPQ
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atggccccgacccactttcaaccgcgccagcacccgcagttgatggcgctgctgcatcgc
atcttggagcggatacagtccgatcacctcgatgcggtcgggttggcgatcactgtgcac
gacaagcgcgccggcgaggtgccgtccgtgctcgccgcgatcggtgtcggtgccgacatc
gccgaagcgcagctcgcaggaatcggcggtccggttcctgatgcccatgcgtatcaggtg
ccggtgctgagcctcgacctgtggaccgacgaccgctggccagggctgaccgtggccacg
atgaacgaccgtgcgccacaacatgaatcgatctgggaacaggtgcacggcgccgccgcc
gtgccgggtgtgtgggccgacgatgcgacggtcgtcgtctgctgcacgctgtcccagccg
gccggcgcggcgacggtggccagcctgatcaactatgaacagctcatctctgcggcgctg
atcaccacggcggcggagaacgcgtcggcgatcgccgacatcatcacggttctgcagtcg
cgcggcgcgatcgaacaggccaagggtgcgctcatgggcctggtgcgttgcgacgccgac
catgcatggcagatgctgcgccgcggtagccaggagttcaacgtgaagctgagggaactg
gccgtcgcgctcctcgagcacatcagtggcgcgcccgccgagcagcccgacaccggaacg
ccgatcacaccagacgagcgcacccgcgaggctgcccggttgatgtgggccgcactctcg
gaagccccactaccgcaatag

DBGET integrated database retrieval system