KEGG   Mycobacterium sp. JS623: Mycsm_06345Help
Entry
Mycsm_06345       CDS       T02423                                 

Definition
(GenBank) galactose-1-phosphate uridylyltransferase, family 1
  KO
K00965  UDPglucose--hexose-1-phosphate uridylyltransferase [EC:2.7.7.12]
Organism
msa  Mycobacterium sp. JS623
Pathway
msa00052  Galactose metabolism
msa00520  Amino sugar and nucleotide sugar metabolism
msa01100  Metabolic pathways
Module
msa_M00554  Nucleotide sugar biosynthesis, galactose => UDP-galactose
Brite
KEGG Orthology (KO) [BR:msa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    Mycsm_06345
   00520 Amino sugar and nucleotide sugar metabolism
    Mycsm_06345
Enzymes [BR:msa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.12  UDP-glucose---hexose-1-phosphate uridylyltransferase
     Mycsm_06345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GalP_UDP_transf GalP_UDP_tr_C
Motif
Other DBs
NCBI-ProteinID: AGB26497
UniProt: L0J797
Position
complement(6303156..6304247)
Genome map
AA seq 363 aa AA seqDB search
MTDPTRWPLADGRELLMFALPGHTPAPVPDRRPLPPRSDQQSQLRFDRQTGQWVIIAALR
QDRTYKPPPDQCPLCPGPTGLISEIPAASYDVAVFENRFPSLSGAGSAAFHLPFPDGDLF
QSAPGHGRCEVICFSSDHTGSFGQLSPQHARLVVDAWRHRTADLMARPGIANVFCFENRG
EEIGVTLTHPHGQIYGYPYLPPRAAEMLREARAYADRTGGNLFTDILAREVADGSRIIAG
TELFTAFVPFAARWPVEVHIYPNRFVHNLVDLTDEERDGFAQIYLDVLKRFDRMYPTALP
YISALHQYSSSGEQREGYFHVELMSVRRSATKLKFLAGSESAMDAFISDVTPESVAERLR
QLA
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgacccgacgaggtggccgctggccgacggccgcgagctgttgatgttcgcgctg
cccgggcacaccccggcgccggtgcccgaccgacgcccgctgcccccgcgctcagatcag
cagtcgcagttgcgattcgaccgccagaccgggcaatgggtgatcatcgcggctctgcgc
caagaccgcacctacaagccgcccccggaccaatgcccgctgtgcccgggccccaccggc
ctgatcagtgagatccccgcggcctcctacgacgtcgcggtcttcgagaaccggttcccc
agtctgtccggcgcgggcagtgctgccttccatcttccgttccctgacggcgatcttttc
cagtccgccccgggccacggtcgatgcgaagtcatctgcttctcgagcgaccacaccggc
tcgttcggtcagctctcgccgcagcatgcgcgcctcgtcgtcgacgcgtggcggcaccgc
accgcggatctgatggcgcgcccgggcatcgcgaacgtgttctgcttcgagaaccgcggc
gaggagatcggggtgacgttgacccacccgcacggtcagatctacggctatccatatctg
ccgccgcgcgcggcggagatgctgcgagaggcccgcgcgtatgccgaccgcaccggtggc
aacctgttcaccgacatcctcgcccgcgaagttgccgacggcagccgcatcatcgccggc
accgaattgttcaccgcgttcgtgcccttcgccgcgcggtggccggtggaggtgcacatc
tacccgaaccggttcgtacacaacctggtcgacctgaccgacgaggagcgtgacggcttc
gcgcagatctacctagacgtgctgaagcggttcgatcgcatgtatccgactgcgctgccg
tatatttcggcgctgcatcaatactccagctccggcgagcagcgtgagggatacttccat
gtcgagctgatgtcggtacggcgcagcgcgaccaaactgaagttcttggccggctccgag
tccgcgatggacgcgttcatcagcgacgtgacgcccgaaagcgtggccgagcgactgcgg
cagctggcatga

DBGET integrated database retrieval system