KEGG   Mycobacterium sp. JS623: Mycsm_06347Help
Entry
Mycsm_06347       CDS       T02423                                 

Definition
(GenBank) SSS sodium solute transporter
  KO
K03307  solute:Na+ symporter, SSS family
Organism
msa  Mycobacterium sp. JS623
Brite
KEGG Orthology (KO) [BR:msa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Mycsm_06347
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SSF
Motif
Other DBs
NCBI-ProteinID: AGB26499
UniProt: L0J5C7
Position
6305159..6306850
Genome map
AA seq 563 aa AA seqDB search
MTENVLRLNLGWLDYVLVAIYFVFVLGIGFIARSQISTSLDFFLSGRRLPAWVTGLAFIS
ANLGAVEIMGMSANGAQVGLSTMHYYWIGAIPAMLFLGVVMMPFYYGSKVRSVPEFMRRR
FGPGAHLVNAISFATAQVLIAGVNLFLLATVINALLGWPRWVSLIVAALVVLSYITLGGL
SAAIYNEVLQFFVIVAALVPLTIFGLVKIGGWNGLRDKVIDTMTDGKVTATTHEQLTTWP
GTALSGFASPVWSVIGIVFGLGFVLSFGYWTTNFVEVQRAMASSSISAARRAPIIGSFPK
MFIPFVIIVPGMIAAASIGDMIRLKTTGKGDITYNDAMLLMIRDILPNGLLGVAIAGLLA
SFMAGMAANISAFNTVFSYDIWQDYVIKDRPDSYYIAVGRIATVAATILAIFTALIAAGY
SNLMDYLQTLFGFFNAPLFATFILGMFWKRMTSTAGWVGLVSGTLSAIFIFILSKVGVLS
LPGQGVPFVAASVAFVVDIAVSVAVTMVTSPKPANELVGLVYSETSKDVFSDPESAGKAW
YYKPVPLATVSLVMVIMLNIVFH
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgacagagaacgtgctgcgcctcaacctcggctggctcgactacgtgctcgtcgcgatt
tacttcgtgttcgtcctcggcattggcttcatcgcccgaagccagatctcgacaagcctg
gacttcttcctctccggccgccgactgcccgcctgggtgaccggcctggcattcatctcg
gcgaacctcggcgccgtcgagatcatgggcatgtccgccaacggtgctcaggtcggactg
tcgaccatgcactactactggatcggcgcgatcccggccatgctgttcctcggtgtggtg
atgatgccgttctactacggctccaaggtgcgaagcgtgcccgagttcatgcggcggcgg
ttcggcccaggcgcccatttggtgaacgcgatcagtttcgccaccgcgcaggtgctcatc
gccggcgtcaacctgttcctgttggcgacggtgatcaatgcactgctcggctggccgcgg
tgggtgtcgctgatcgtcgcggcgctggtggtgctcagctacatcacgctcggcggcctt
tctgcggcgatctacaacgaggtcttgcagttctttgtgatcgtcgcggcgctggttccg
ctgaccatcttcggcctggtcaagatcggcggctggaatggcttgcgggacaaagtcatc
gacacgatgacggacggcaaggtgaccgcgactacgcacgagcagctcaccacatggccc
ggtacggcattgtccggcttcgcaagcccggtgtggtcggtgatcggcatcgtgttcggc
ctcgggttcgtgctctcattcgggtactggaccaccaacttcgtcgaagtgcagcgcgcg
atggcgtccagttcgatctcggcggcgaggcgcgccccgatcatcggctcgttcccgaag
atgttcattccgttcgtgatcatcgtgcccggcatgatcgccgccgcttcgatcggcgac
atgatccggctgaaaacgactggcaagggcgacatcacgtacaacgacgcgatgctgctg
atgatccgcgacatcctgcccaacggcttgctcggggtcgcgatcgcgggcctgcttgcg
tcgttcatggccggtatggcggccaacatctcggcgttcaataccgtgttcagctatgac
atctggcaggactacgtcatcaaggaccgacccgacagctactacatcgcggtgggtcgg
atcgccactgtcgcagcgaccatcctggccatcttcaccgcgttgatcgctgcgggttac
tccaacctgatggactacctgcagacgctgttcgggttcttcaatgcgccgttgttcgcc
acgttcatcctcggcatgttctggaagcgcatgacatcgaccgcgggctgggtcggcctt
gtctccggaaccctttctgcgatcttcattttcattctgtccaaggtcggtgtgctcagc
ctgcccggccagggtgtgccgttcgtcgcagcatcggtggcgttcgtcgtcgacatcgcc
gtcagcgtagcggtcaccatggtgacatctccgaagcctgccaacgaattggtggggctg
gtgtactcggagacgtcgaaggacgtcttctccgatcccgagagcgccggaaaggcctgg
tactacaagcctgttccgctcgccaccgtttcgctggtcatggtcatcatgctcaacatc
gttttccactag

DBGET integrated database retrieval system