KEGG   Mycobacterium sp. JS623: Mycsm_06355Help
Entry
Mycsm_06355       CDS       T02423                                 

Definition
(GenBank) hypothetical protein
Organism
msa  Mycobacterium sp. JS623
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF899
Motif
Other DBs
NCBI-ProteinID: AGB26507
UniProt: L0J7A6
Position
6310572..6310910
Genome map
AA seq 112 aa AA seqDB search
MDLPAVVSPQEWDAVPQDLLVKEKEHTRAAMRWPHNVAGCRGWRSKNDCLFDGPGGPASL
LDLFDACDTGVEVTSSKMDESSERKVLTPPVEPAMVPTAAGTEATLQPVPPR
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atggacttgccagcggtcgtctcaccgcaggagtgggatgccgtcccccaggacttgctc
gtgaaggaaaaggagcacacgcgtgccgcgatgcgctggccgcacaacgtcgcaggatgc
cgaggatggcggtcgaaaaacgactgcctgttcgacggtcccggtgggccggccagcctg
ctcgatctgttcgatgcctgtgacaccggcgtcgaggtcacgtcgtccaaaatggacgag
tcatcagaacgtaaagtcctaacaccgccagtggagccagcaatggtacccacggcagct
ggaacggaagcgacactgcagccagtcccgccgcggtaa

DBGET integrated database retrieval system