KEGG   Mycobacterium sp. JS623: Mycsm_06356Help
Entry
Mycsm_06356       CDS       T02423                                 

Definition
(GenBank) hypothetical protein
Organism
msa  Mycobacterium sp. JS623
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ifi-6-16
Motif
Other DBs
NCBI-ProteinID: AGB26508
UniProt: L0J6K1
Position
complement(6310789..6311226)
Genome map
AA seq 145 aa AA seqDB search
MSIPKTTVPATRAVSTAFGLVMVASAAVQADGPALIAAVVAAAAVLLSSWIRPAAAIAVL
CTVAVIMLADAPPLVTATAGLCAAAYLVLRHTPAVSAPTVLGAVGFTAAGLAAVSLPFQL
PWVPLLAPLAVLGLYVLMTRPFWTT
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcccgaagacgactgtgccggccacccgcgccgtctcgactgcgtttggtctg
gtgatggtggcatcggccgcagtccaggccgacgggccggcgctgatcgcggccgtcgtc
gcggcggctgcggtgttgctgagcagttggattcggccggcagcagcgatcgccgtgctg
tgcaccgtcgcggtgatcatgctcgccgacgcgccgccgctggtgaccgcgacagcgggc
ctgtgcgccgcggcgtacctcgtgttgcgacacaccccggcggtgagtgcgccgaccgtg
ctcggcgccgtcgggtttaccgcggcgggactggctgcagtgtcgcttccgttccagctg
ccgtgggtaccattgctggctccactggcggtgttaggactttacgttctgatgactcgt
ccattttggacgacgtga

DBGET integrated database retrieval system