KEGG   Mycobacterium sp. JS623: Mycsm_06362Help
Entry
Mycsm_06362       CDS       T02423                                 

Definition
(GenBank) enoyl-CoA hydratase/carnithine racemase
Organism
msa  Mycobacterium sp. JS623
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 SDH_sah
Motif
Other DBs
NCBI-ProteinID: AGB26514
UniProt: L0J5E1
Position
complement(6315688..6316407)
Genome map
AA seq 239 aa AA seqDB search
MDVQLADGVTTVRIDHPPVNAFNLGLVEDAIATVRSIDGPIVLTGAGACFSAGVDLRALL
DGPPEYTDTFLAAVSEAFLTVFDHPAPVVAAVNGHAIAGGCVLAMAADIRLMSSGLIGLS
EVAVGVPFPVAALEICRYAMGPSVTRAVLQADNVDVGIAAGRGWIDEVVAPDELVPRAVE
VARALGQHPATAYAAMKEQLHRHARAAIDAGVELDAGVRAVWKSDETRGRISAFLDALK
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atggacgtgcaacttgccgacggtgtgactaccgtccgcatcgaccatccgccggtcaac
gccttcaatctcggcctggtcgaagacgcgattgccacggtccgcagcatcgacggaccg
atcgtgctcaccggggcgggtgcgtgcttctcggccggcgtcgacctgcgcgcgctgctc
gacgggccgccggagtacaccgacacgttcctcgccgcggtgtcggaggcgttcctgacg
gtcttcgatcacccggcgccggtggtggcggcggtgaacggacatgcgatcgcgggcggc
tgtgtgttggcgatggccgccgacatccgcctcatgtcgtcggggctgattgggctgagc
gaggtggcggttggcgtgccgttcccggtcgctgcgctcgagatttgtcgatacgcgatg
ggcccgtcggtgacacgcgcggtcctgcaggccgacaacgtcgacgtcggcatcgcggcc
ggccgtggttggatcgacgaagtcgtcgcgcccgacgagctggtaccccgtgccgtcgag
gtcgcccgcgcgctgggccaacacccggccacagcctatgcggcgatgaaggagcagcta
caccggcatgcccgcgccgccatcgacgctggcgtcgagctggacgccggggtgcgggcc
gtctggaagtcggacgagacgcgaggccggatctctgctttcctggacgcgcttaagtga

DBGET integrated database retrieval system