KEGG   Mycobacterium sp. JS623: Mycsm_06367Help
Entry
Mycsm_06367       CDS       T02423                                 

Definition
(GenBank) RNA polymerase sigma-70 factor, TIGR02960 family
  KO
K03088  RNA polymerase sigma-70 factor, ECF subfamily
Organism
msa  Mycobacterium sp. JS623
Brite
KEGG Orthology (KO) [BR:msa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:msa03021]
    Mycsm_06367
Transcription machinery [BR:msa03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Sigma factors
     Mycsm_06367
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma70_r2 Sigma70_r4_2 SnoaL_2 Sigma70_r4 NTF2 Sigma70_ECF DUF4440 SnoaL_4 SnoaL_3
Motif
Other DBs
NCBI-ProteinID: AGB26519
UniProt: L0J5E6
Position
6320481..6321428
Genome map
AA seq 315 aa AA seqDB search
MPAQQEFIEQAAPFRAELIAHCYRMLGSVQDAEDLVQETYLRGWRGYEAFEERAALRTWL
YRIATTACLRALQNRARRVLPAGLGAGSVDPEVDIDASKAGFPWLEPIPDTFTPEAAVTA
RQSIRLAIVTAMQELPARQRAVLILRDVVQFSAAEVAELLETTPAAVNSALQRARAHLAE
VAPSDDDVIEPEDRELLALVERYCAAFENGDMAALTALLRADVKLEMPPFAVWFTGRDAV
TRFLSARAFAEPDAVLMVPTSANGQPAVADYRRDAGGVLQAHAIHVLTPGEDGIAAITVF
LDPDLFSVFGLPSSR
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
gtgccggctcagcaggagttcatcgaacaggcagcgccgtttcgcgccgagttgattgcg
cattgttaccgcatgctgggttcggtgcaggacgccgaggacctggtgcaggaaacgtac
ttgcgcggctggcgcggttacgaggcgttcgaggaacgcgcggccctacggacctggctg
taccgcattgcgaccaccgcgtgcctgcgggcgctgcagaaccgcgcgcggcgggtgttg
cccgccggactcggcgcgggttccgttgatcccgaggtggacatcgacgcgagcaaggcc
gggtttccctggctcgagccgattccggacacgttcacacccgaggccgcggtgaccgcg
cggcagagcattcggctggcgatcgtgacggcgatgcaggagctgcctgctcgccagcgg
gcggtgctgatcctgcgcgatgtggtccagttcagtgcggcggaggtggccgaactgctg
gagaccacgcccgccgcggtcaacagcgcgctgcagcgggcgcgggcccatctcgccgaa
gtcgcgccaagcgacgacgacgtcatcgaacccgaagaccgggagctgctcgcacttgtc
gaacgctattgcgcggcgttcgaaaacggcgacatggccgccttgaccgcgctgctgcgg
gccgacgtcaagcttgagatgccgccgttcgccgtctggttcaccggccgtgacgcggtg
acgcgattcctctcggcgcgtgcgttcgcagaacccgacgctgtgttgatggtgccaaca
tccgccaatggccaaccggcggttgccgattaccgccgcgatgccgggggcgtgttgcag
gcccacgcgatacatgtgctcactcctggcgaggacggaattgccgcgatcaccgtgttt
ctcgacccggacctgttttccgtgttcggtctgccctcaagtcgatga

DBGET integrated database retrieval system