KEGG   Mycobacterium sp. JS623: Mycsm_06370Help
Entry
Mycsm_06370       CDS       T02423                                 

Definition
(GenBank) lactoylglutathione lyase-like lyase
Organism
msa  Mycobacterium sp. JS623
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyoxalase Glyoxalase_4
Motif
Other DBs
NCBI-ProteinID: AGB26522
UniProt: L0J7B9
Position
complement(6322808..6323212)
Genome map
AA seq 134 aa AA seqDB search
MRFDLLTPGIEVGLVTTNLDAMVAFYEGFLGLDLQGEVEFPGGSQRRYSLGNGVVKLVTY
DPPPAPAAPGGGRAQAGVRYFTIGVQNLRTVAKEFEGSEYEIVEPVTEFAPVPGMGWMFV
ADPDGNWIELFGTL
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
gtgcgattcgacctgttgacccccggcatcgaagtcggccttgtgacgaccaaccttgac
gcgatggtcgccttctacgaggggttcctcgggttggaccttcagggcgaggtggagttc
cccggcggttcgcagcgtcggtactcgctgggcaacggcgtagtgaaactcgtgacgtat
gacccgccgccggcacccgccgctcccggcggtggccgcgcgcaagcgggcgtccgctac
ttcaccatcggggtgcaaaacctgcgcactgtggccaaggagttcgagggctccgaatac
gagatcgtcgagcccgtgacggagttcgctccggtgccaggcatggggtggatgttcgtc
gccgaccccgacggcaactggatcgaattgttcggaacgttgtga

DBGET integrated database retrieval system