KEGG   Mycobacterium sp. JS623: Mycsm_06372Help
Entry
Mycsm_06372       CDS       T02423                                 

Definition
(GenBank) hypothetical protein
Organism
msa  Mycobacterium sp. JS623
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AGB26524
UniProt: L0J5F1
Position
6324108..6324554
Genome map
AA seq 148 aa AA seqDB search
MRSTRTTAAAGIVLLGWAASPAIASADPAPAPPPGPKTTIDGDGTYAVGKDIQPGTYSSA
GPVGDGACYWKRTSGTTIVDNALSKKAQIVQIDATDTSFTTNECQAWQLTDAPVPQSGPG
DLMGALGQLGQIIARNPGGAPPPANPGG
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgaggtcgacacgcacaactgcggccgcggggatcgttctcctcggctgggccgcgtcc
cccgcgattgcctcggctgatcccgctcctgcgccgccgccagggcccaagacgacgatc
gacggcgacggcacctacgcggtcggcaaggacattcagccgggcacgtacagctcggca
ggcccggtcggcgacggcgcctgctactggaagcgcaccagcgggacgaccatcgtcgac
aacgcgctgtcgaagaaggcgcagattgttcagatcgacgcgaccgacacgtcgttcacc
accaacgaatgccaggcctggcagctgaccgacgcgcccgtgccccagtcggggccaggt
gacctgatgggcgcgctgggccagctcgggcagatcatcgcccgcaatcccggcggtgcg
cccccgcccgccaatcccggcggttag

DBGET integrated database retrieval system