KEGG   Mycobacterium sp. JS623: Mycsm_06378Help
Entry
Mycsm_06378       CDS       T02423                                 

Definition
(GenBank) response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain
Organism
msa  Mycobacterium sp. JS623
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg
Motif
Other DBs
NCBI-ProteinID: AGB26530
UniProt: L0J4N7
Position
complement(6327681..6328139)
Genome map
AA seq 152 aa AA seqDB search
MTIEGRETDDGRAIDVLLVEDDPGDELITREAFEHNKIKNTLHVAHDGEEGLDFLYQRGA
FENAPRPDLILLDLNLPKYDGRQLLEKIKSDPELCHIPVVVLTTSSAEEDILRSYKLHAN
AYVTKPVDLDQFMSAVRQIDEFFVQVVRLPQF
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgaccatagagggccgagaaaccgacgatggccgcgcaatcgatgtgcttttggtcgaa
gacgaccctggcgatgagctgatcacccgggaagcgttcgaacacaacaagatcaaaaac
actttgcatgtcgcccacgacggcgaggagggcctggacttcctctaccaacgcggggcg
ttcgaaaatgcgccgcggccggatctgatcctgctcgatctgaatctgcccaaatacgat
gggcgccaactgctcgagaagatcaagtcagaccccgagctgtgtcacatcccggtcgtc
gtgctcaccacgtcgtcggcggaagaggacattctgcgcagctacaagctgcacgccaac
gcgtatgtgaccaagccggtggatctggaccagttcatgagcgcggtccgccagatcgac
gagttcttcgtccaggtggtgcggctgccgcagttctag

DBGET integrated database retrieval system