KEGG   Mycobacteroides salmoniphilum: DSM43276_01084Help
Entry
DSM43276_01084    CDS       T06041                                 

Gene name
ald_1
Definition
(GenBank) 3-succinoylsemialdehyde-pyridine dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
msal  Mycobacteroides salmoniphilum
Pathway
msal00010  Glycolysis / Gluconeogenesis
msal00053  Ascorbate and aldarate metabolism
msal00071  Fatty acid degradation
msal00280  Valine, leucine and isoleucine degradation
msal00310  Lysine degradation
msal00330  Arginine and proline metabolism
msal00340  Histidine metabolism
msal00380  Tryptophan metabolism
msal00410  beta-Alanine metabolism
msal00561  Glycerolipid metabolism
msal00620  Pyruvate metabolism
msal00625  Chloroalkane and chloroalkene degradation
msal00903  Limonene and pinene degradation
msal01100  Metabolic pathways
msal01110  Biosynthesis of secondary metabolites
msal01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:msal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DSM43276_01084 (ald_1)
   00053 Ascorbate and aldarate metabolism
    DSM43276_01084 (ald_1)
   00620 Pyruvate metabolism
    DSM43276_01084 (ald_1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DSM43276_01084 (ald_1)
   00561 Glycerolipid metabolism
    DSM43276_01084 (ald_1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DSM43276_01084 (ald_1)
   00310 Lysine degradation
    DSM43276_01084 (ald_1)
   00330 Arginine and proline metabolism
    DSM43276_01084 (ald_1)
   00340 Histidine metabolism
    DSM43276_01084 (ald_1)
   00380 Tryptophan metabolism
    DSM43276_01084 (ald_1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    DSM43276_01084 (ald_1)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    DSM43276_01084 (ald_1)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    DSM43276_01084 (ald_1)
Enzymes [BR:msal01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     DSM43276_01084 (ald_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: QCH22838
Position
1081570..1083039
Genome map
AA seq 489 aa AA seqDB search
MALLADGDSDLFIDGKLIPGGAGRFPTVNPATEEVLGTAADADIDDMSHAIEAARRAFDD
TDWSRDVGLRVQCLRQLRDGMRAHVEELRELTIAEVGAPRMLTAGAQLEGPVDDLRFAAD
TAESFDWNADLGVAAPMGIKTRRTLAREAVGVVGAVTPWNFPHQINLAKVGPALAAGNTL
ILKPAPDTPWCAAVLGRIIAEHTDFPPGVFNIVTASDHRIGALLSTDPRVDMVSFTGSTA
TGRAVMTDAAATVKKVFLELGGKSAFIVLDDAELSGACSVAGFTAAMHAGQGCAITTRLV
VPRARYDEAVQAAAATMGSLKPGDPNKPGTVCGPVISARQRDRVQSYLDLAIAEGGSFAC
GGGRPEGKDRGFYIEPTVVAGLTNDARVAREEIFGPVLVVIAHDGDDDAVRIANDSPYGL
SGTVFSGDDERAARVASRLRVGTVNVNGGVWYSADAPFGGYKQSGIGREMGVAGFEEYLE
TKVIATAVK
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggcactcctggccgatggtgacagtgatctgttcatcgacggaaagttgattcccgga
ggtgccgggcggttcccgacggtgaacccggccaccgaggaggtgctcggtaccgcggcc
gatgccgacatcgatgacatgagccatgccatcgaggcggcgcgtcgggcgttcgacgac
accgattggtcacgggatgtgggtctgcgcgtgcagtgtctccgtcagctgcgcgatggc
atgagggctcatgtcgaagaattgcgagaactgaccatcgccgaggtgggggcgccccgg
atgctgaccgccggtgcgcagctcgaggggccggtggacgatctgcgcttcgccgccgat
accgcggaatcctttgactggaacgccgatctcggtgtcgccgcgcctatgggtatcaag
accaggcgcaccctcgctcgtgaggccgtcggcgtggtcggggcggtgacgccgtggaac
tttccgcatcagatcaacctcgccaaggtcggcccggcgctggcggctggtaacaccctg
atactcaagccggcaccggataccccatggtgtgcagcggtactggggcgaatcatcgcc
gaacacaccgactttccgccgggcgtcttcaacatcgtcaccgccagtgatcaccgcatc
ggtgcgctgctgtcgacggatccccgggtggacatggtgtcgttcaccggctccacggcg
accgggcgcgcggtgatgaccgatgcggccgccaccgtcaagaaggtgtttctggaactc
ggcggcaagtcggcattcattgtgcttgacgacgcagagctgagcggggcgtgctccgtc
gccggatttaccgcggccatgcatgccggccagggttgcgcgatcaccacccggttggtg
gtgccgcgcgcacgctatgacgaggcggtgcaggcggcggcggcgaccatgggttccctg
aaaccgggggatcccaacaagccgggaaccgtatgtggaccggttatctcggcgcgccag
cgcgacagggtccagtcctatttggatctggctatcgccgagggtggttcgttcgcctgt
ggaggcgggcgacccgagggcaaggatcgaggtttctatatcgagcccaccgtcgtcgcc
gggctgaccaacgacgcacgggtggcacgcgaggagatcttcggtcccgtactcgtggtg
atcgcgcacgacggcgacgacgacgcggtgcggatcgccaacgattcaccgtatggactg
tccgggacggtcttcagtggggacgacgaacgcgcggcgcgggtcgcgtcgcggctacgg
gtcggaaccgtgaatgtcaacggcggtgtctggtactccgcagacgcccccttcggtggg
tacaagcaatcgggtatcggcagggaaatgggtgtagccggtttcgaggagtacctggaa
accaaagtcattgcaacggctgtgaagtag

DBGET integrated database retrieval system