KEGG   Mycobacteroides saopaulense: MYCSP_03020Help
Entry
MYCSP_03020       CDS       T05445                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
msao  Mycobacteroides saopaulense
Pathway
msao00480  Glutathione metabolism
msao00590  Arachidonic acid metabolism
msao01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:msao00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    MYCSP_03020
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    MYCSP_03020
Enzymes [BR:msao01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     MYCSP_03020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx Redoxin AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: ALR13855
UniProt: A0A1S4VSN3
Position
606651..607139
Genome map
AA seq 162 aa AA seqDB search
MTDLASIPLTALDGSELSLSEYAGRAVLVVNVASKCGLTPQYAALEKLATDYADRGLTVL
GVPCNQFMGQEPGTAEEIQTFCSTTYGVSFPLLEKTDVNGESRHPLYVELTKTADATGAA
GDVQWNFEKFLIARDGSVTNRFRPTTVPDAPEVIAAIEKELG
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatctcgcctccatcccgttgaccgccctggacggctcggagctgtcactgtcc
gaatacgccggccgcgccgtgctggtggtcaacgtcgcgtccaaatgcggcctgaccccg
cagtacgcggcattggagaagctggccaccgactacgccgaccgcggtttgacggtgctc
ggggtgccctgtaaccagttcatgggccaggagccgggcacggcggaagaaattcagacg
ttctgttccaccacctacggcgtgagtttcccgctgctggagaagaccgacgtcaacggc
gagagcaggcatccgctgtacgtcgagctcaccaagaccgcggatgccacgggcgccgcc
ggggacgtgcagtggaacttcgagaagttcttgatcgcacgggatggctcggtgaccaac
agattccggccgacgacggtgccggacgctcccgaggtgatcgcggccatcgagaaggag
ctggggtag

DBGET integrated database retrieval system