KEGG   Mycobacteroides saopaulense: MYCSP_05750Help
Entry
MYCSP_05750       CDS       T05445                                 

Definition
(GenBank) pterin-4-alpha-carbinolamine dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
msao  Mycobacteroides saopaulense
Pathway
msao00790  Folate biosynthesis
msao01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:msao00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MYCSP_05750
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:msao04147]
    MYCSP_05750
Enzymes [BR:msao01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     MYCSP_05750
Exosome [BR:msao04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MYCSP_05750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: ALR13923
Position
complement(1156583..1156867)
Genome map
AA seq 94 aa AA seqDB search
MALLTDDQINAALAGLSGWTSEGDSLRRVVRFNAFLDGIDAVRRIAEHAESVDHHPDIDI
RWRTVTFVLSTHSEGGITDKDVALAQTIDAQVGG
NT seq 285 nt NT seq  +upstreamnt  +downstreamnt
atggctctgctcaccgatgaccagatcaacgcagcgctcgccggactttccggctggact
agcgagggcgactctctgcgccgcgtcgtcaggttcaacgccttcctcgacggcatcgac
gcggtgcggcgcatcgccgagcacgccgaatccgtcgaccatcatcccgatatcgatatc
cgatggcgcacagtgacgtttgtactgtccacccattccgagggcggcatcaccgacaag
gacgtggcactggcgcagacgatcgacgcgcaggtcggcggttag

DBGET integrated database retrieval system