KEGG   Mycobacteroides saopaulense: MYCSP_15040Help
Entry
MYCSP_15040       CDS       T05445                                 

Definition
(GenBank) glutamyl-tRNA synthetase
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
msao  Mycobacteroides saopaulense
Pathway
msao00860  Porphyrin and chlorophyll metabolism
msao00970  Aminoacyl-tRNA biosynthesis
msao01100  Metabolic pathways
msao01110  Biosynthesis of secondary metabolites
msao01120  Microbial metabolism in diverse environments
Module
msao_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:msao00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MYCSP_15040
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    MYCSP_15040
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:msao01007]
    MYCSP_15040
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:msao03016]
    MYCSP_15040
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:msao02048]
    MYCSP_15040
Enzymes [BR:msao01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     MYCSP_15040
Amino acid related enzymes [BR:msao01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   MYCSP_15040
Transfer RNA biogenesis [BR:msao03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    MYCSP_15040
 Prokaryotic type
   Other AARSs
    MYCSP_15040
Prokaryotic defense system [BR:msao02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    MYCSP_15040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1c DUF3248
Motif
Other DBs
NCBI-ProteinID: ALR12499
UniProt: A0A1S4W2S9
Position
complement(3039761..3041251)
Genome map
AA seq 496 aa AA seqDB search
MSDTKVRVRFCPSPTGTPHVGLIRTALFNWAYARHCGGDFVFRIEDTDAGRDSEESYLAI
LDALRWLGLDWDEGPEVGGPYAPYRQSQRKELHLDVVRKLLEAGEAYEAFSTPEEVEARH
LAAGRNPKLGYDNYDRDLTDEQRAAFRAEGRNPVVRLRMPDHDITWNDLVRGETTFAAGV
VPDFALTRGNGDPLYTLVNPVDDALMKITHVLRGEDLLPSTPRQIALYEAMIRVGVAESI
PTFAHLPSVLGEGTKKLSKRDPQSNLFLHRDRGFIPEGLLNYLALLGWSIADDHDIFSLQ
EMVAAFDVTDVNSNPARFDQKKADAINAEHIRLLAPEEFVARLQTFFTGHGYELGLDESA
FTVAADLVQTRIVVLGDAWGLLKFLNDDVYAIDPGSARKELGEASVPVLDAAIGALESLD
AWTTQAIEEALKSALVEGLELKPRKAFGPLRVAVTGATVSPPLFESMELLGSARTLQRLR
NARTWENEVEGQTDSG
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgacactaaagtccgggtacgtttctgtccgtcgccgacgggtaccccgcacgtc
ggtctgatccggaccgcgctgttcaactgggcgtacgcccgacactgcggaggcgacttc
gtgttccgcatcgaggacaccgacgccgggcgcgacagtgaagagagctatctggcgatc
ctggacgccttgcggtggttgggcctggactgggacgagggccccgaggtcggtggccct
tacgcgccgtatcggcagtcgcagcgtaaggaactgcacctcgatgtggtgcgcaagctg
ctggaggcgggggaggcctatgaggcattctccacgccggaagaggtggaggctcgccac
ctcgcggcggggcgcaatcccaaactggggtacgacaattacgaccgcgatctcaccgac
gagcagcgtgcggccttccgggcagagggccgcaaccccgtcgtgcggctacgcatgccc
gatcacgacatcacctggaatgacttggtgcgcggggagaccaccttcgcggccggcgtg
gtgcccgatttcgcgctgacccgcggcaatggagatccgttgtacaccttggtgaacccg
gtcgacgacgccctgatgaagatcacccacgtgctgcgcggtgaggacctgctgccatcg
acccccaggcagatcgccttgtatgaggccatgatccgggtgggggtggccgagtcgatt
ccgacgttcgcacacctgccctcggtgctgggtgagggcaccaagaagctatccaagcgt
gatccgcagtccaacctgtttctgcaccgcgatcggggtttcatccccgaggggctgctg
aattaccttgcactgctggggtggtcgatcgccgacgatcacgacattttcagcctgcaa
gagatggtcgccgcctttgacgtcaccgatgtcaattcgaatccggcgcggttcgaccag
aagaaggccgacgccatcaatgccgagcacatccggttgttggccccggaggagttcgtg
gcacggctgcagaccttcttcaccggccatgggtacgagctgggactcgatgagagcgcc
ttcacggtggcggcggacctggtgcagacgcgcatcgtggtgctgggagatgcttggggt
ctgctgaagttcctcaacgacgatgtgtacgccatcgaccccggctcggcacgcaaggag
ttgggggaggcctctgtacctgtcttggacgccgcgatcggcgcgctggagtcgcttgat
gcgtggaccactcaggccatcgaggaggcgctcaagagcgcgctcgtcgaggggctcgaa
ctcaaaccccggaaggcattcgggccgctgcgcgtcgcggtgaccggtgcgacggttagc
cctccgctgttcgaatcgatggaactactgggctccgcgcgcaccctgcagcggctgcga
aacgcccggacctgggaaaatgaggtggagggccaaaccgattcgggttaa

DBGET integrated database retrieval system