KEGG   Mycobacteroides saopaulense: MYCSP_15905Help
Entry
MYCSP_15905       CDS       T05445                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00632  acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
msao  Mycobacteroides saopaulense
Pathway
msao00071  Fatty acid degradation
msao00280  Valine, leucine and isoleucine degradation
msao00281  Geraniol degradation
msao00362  Benzoate degradation
msao00592  alpha-Linolenic acid metabolism
msao01100  Metabolic pathways
msao01110  Biosynthesis of secondary metabolites
msao01120  Microbial metabolism in diverse environments
msao01130  Biosynthesis of antibiotics
msao01212  Fatty acid metabolism
Module
msao_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:msao00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MYCSP_15905
   00592 alpha-Linolenic acid metabolism
    MYCSP_15905
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MYCSP_15905
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    MYCSP_15905
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MYCSP_15905
   00642 Ethylbenzene degradation
    MYCSP_15905
Enzymes [BR:msao01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     MYCSP_15905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ALR12644
Position
complement(3219783..3220976)
Genome map
AA seq 397 aa AA seqDB search
MRDAVIVDAVRTPVGKGKPGGSLSGVHPVDLHAHAIRALVERTGIDPALVDDVISGAVGQ
VGEQSSNTARWAALAAGLPETVPAVTVDRQCGSSQQAIHFAAQGVIAGAYDVVIASGIES
MSRVPMGSQSLGKDFFGSEVAQRYPEGLVPQGISAELIAGKWNLSRAQLDAFSAESHRRA
AQAWAEGRFTRDVVPIKAPNVDGDLVEVSMDESVRPSTTIEVLAGLKPAFRNELWEQRFP
QTDWKVTAGNSSPINDGASAVLITSSETARRLGLTPRARVHSVAVVGDDPLYMLTGVIPA
TAKVLDRAGLSLADIDAFEVNEAFASVVLAWQAETGADVAKVNVNGGAIAIGHPLGASGG
RLMTTLVSVLEQTGGRYGLQTMCEAGGLANATIIERL
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgagagatgcagtgatcgtcgatgcggtacgcacccccgtcggcaaggggaagcccggt
gggtcgctctcaggggtgcacccggtcgatctgcacgcgcacgccatccgtgcactcgtc
gagcgcaccggcatcgacccggcccttgtcgacgatgtgatcagcggtgccgtcggacag
gtgggggagcagagctccaacacggcacgctgggccgcactggccgccgggttgccggag
acggtcccggcggtgaccgtggaccgtcagtgtggcagcagtcagcaggccatccacttt
gccgcacaaggggtcatcgccggcgcctatgacgtggtgatcgcctccgggatcgaatcg
atgagccgggtaccgatgggcagtcaaagcctgggcaaggatttcttcggttccgaagtt
gcccaacgctatccggaaggtcttgttccgcagggcatcagtgccgagctgatcgccggg
aagtggaacctctcgcgcgcgcagctggacgccttctctgccgagagtcatcgccgcgct
gcgcaggcgtgggcggagggcagattcacgcgtgatgtggtgccgatcaaggcgcccaat
gtcgatggtgatctggtcgaggtgagtatggacgaatccgtgcggccgtcgaccaccatc
gaggtactggcggggctcaagcctgccttccgtaacgagctgtgggagcagcgcttcccg
cagaccgattggaaggtcaccgcgggcaactcctcgccgatcaacgacggcgcctcggcg
gtgctcatcacttccagcgagaccgcccgacgtctcggcctgacgccgcgggcgcgagtg
cattcggtcgcagtcgtgggcgacgatccgttgtacatgctcaccggggtcatccccgcc
accgcgaaagtccttgaccgcgcggggttgtccctggccgacatcgacgccttcgaggtc
aacgaggcattcgcatcggtggtcctggcttggcaggccgagacgggggccgatgtggcg
aaggtcaacgtcaacggtggggccattgcgatcggtcaccctctgggggccagcggtggc
cggctcatgaccaccctggtatcggtgctggagcagaccggcgggcgttacggactgcaa
acgatgtgtgaggcgggcggtttggccaacgcgaccatcatcgaacggctctag

DBGET integrated database retrieval system