KEGG   Mycobacteroides saopaulense: MYCSP_22475Help
Entry
MYCSP_22475       CDS       T05445                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
msao  Mycobacteroides saopaulense
Pathway
msao00010  Glycolysis / Gluconeogenesis
msao00020  Citrate cycle (TCA cycle)
msao00620  Pyruvate metabolism
msao01100  Metabolic pathways
msao01110  Biosynthesis of secondary metabolites
msao01120  Microbial metabolism in diverse environments
msao01130  Biosynthesis of antibiotics
msao01200  Carbon metabolism
Module
msao_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:msao00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MYCSP_22475
   00020 Citrate cycle (TCA cycle)
    MYCSP_22475
   00620 Pyruvate metabolism
    MYCSP_22475
Enzymes [BR:msao01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     MYCSP_22475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H RnfC_N
Motif
Other DBs
NCBI-ProteinID: ALR13722
Position
complement(4606770..4608086)
Genome map
AA seq 438 aa AA seqDB search
MAVKQFLLPDLGEGLTEADLIAWKVKVGDEVKLNQVLADVETAKAMVELPSPYEGTVVAL
EAAENSTLAVGAPLISIEVAGAEPDGPANLVGYGPSESSGATRRRRRTASGAAALALVEQ
TEAPEPETVQPAAVTQPSPERVPAKPSVRKLAAELGVTLELISGTGIGGSITRQDVEAYT
RSLTARAPQPEPHTPAAASDIAGAAAPAGAETRIPIAGVRKHTAAAMVRSAFTAPHVTEF
LTVDMTATMELLAELKVRYPDLKLTPTTLVARMVLLTLRSHPSLNSAWDEQAGEIVVKHY
VHLGVAAATARGLVVPNIKSANTMSLRELAGALAQLATTAREGKTAPADMSGGTFTLTNI
GVFGVDAGTPIINPGEAAILALGSVAKRPWVVDGELAVRDVTTLALSFDHRLVDGEQGSK
FLADLGAMLTDPRMALVV
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atggcagtcaaacagtttttgctccccgatctcggagagggcctcaccgaggcggacctg
atcgcctggaaggtgaaggtcggcgacgaggtgaagctgaaccaagtgctcgccgacgtc
gagaccgccaaggcgatggtcgagctgccgtccccgtacgagggcacggtggtggcattg
gaggcggccgagaactcgacgctggcggtgggggcaccgctgatctccatcgaggtggcc
ggcgccgaaccggacgggcccgccaaccttgtcggctacgggccgtcggaatccagcggc
gccacccgtcgtcggcgacgcacggcatccggtgcggcggcactcgcgctcgtggaacag
acggaagcccctgaacccgagactgttcaaccggctgcggtgacacaaccgtcgccggag
agggtcccggcgaaaccgtcggtccgtaagctggccgccgagctcggcgtgactctcgaa
ctgatcagtggcacggggatcggcggcagcatcacccggcaagacgtggaggcctacacg
cgcagcctcaccgcgagggcgccgcagcccgaaccccacacccccgccgcggcatcggat
atcgccggtgcggcggctcccgccggcgccgagacccgcattccgatcgcgggcgttcgc
aagcacacggccgccgcgatggtgcgcagtgccttcacggcaccgcatgtcaccgaattc
ctgaccgtggacatgaccgcgacgatggagctgttggcggagttgaaggtgaggtatccc
gacctcaaactcacgccgaccaccctggtggcacggatggtgctgttgacgctgcggtcg
catccctcgctcaactccgcctgggacgagcaggccggcgagatcgtcgtgaagcactac
gtacacctcggtgtggcagccgccaccgcgcgtgggctggtggtgccgaacatcaagagc
gccaacacgatgtcgttgcgggagctggcgggtgccctcgcgcagttggcgacaacagcg
cgggagggcaagaccgcccctgccgacatgagcggtgggacgttcaccctgaccaacatc
ggggtgttcggcgtcgacgccggtactccgatcatcaatccgggtgaggccgcgatcttg
gcgctgggttcggtcgccaagcgcccgtgggtggtggacggcgagctcgcggttcgcgac
gtcacgacgctggcgctgtcgttcgatcaccggctggtggacggcgagcaggggtcgaaa
ttcctcgcggatctgggtgcgatgctcaccgacccgcggatggccctggtggtttag

DBGET integrated database retrieval system