KEGG   Mycolicibacterium smegmatis MC2 155: LJ00_00130
Entry
LJ00_00130        CDS       T03433                                 

Definition
(GenBank) septation inhibitor protein
Organism
msb  Mycolicibacterium smegmatis MC2 155
SSDB
Motif
Pfam: CrgA
Other DBs
NCBI-ProteinID: AIU05310
Position
complement(46416..46700)
AA seq 94 aa
MPKSKVRKKNDFTSRPVSRTPVKVKAGPSSVWFVALFIGLMLFGLIWLLVFQLAATNPID
TPSFLQWMADLGPWNYAIAFAFMITGLLLTMRWR
NT seq 285 nt   +upstreamnt  +downstreamnt
atgcccaagtccaaagtccgcaaaaagaacgacttcacctccaggccggtgagccggacc
ccggtgaaggtgaaggccggaccgtccagtgtctggttcgtcgctctgttcatcggcctc
atgctgttcggtctcatctggctactggtgttccagctggcggcaaccaacccgatcgac
accccgtcgttcctccagtggatggcggatctcggtccgtggaactacgcgatcgccttt
gctttcatgatcaccggtctgttgctcaccatgcgctggcgctga

DBGET integrated database retrieval system