KEGG   Mycolicibacterium smegmatis MC2 155: LJ00_01535Help
Entry
LJ00_01535        CDS       T03433                                 

Definition
(GenBank) arylamine N-acetyltransferase
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
msb  Mycolicibacterium smegmatis MC2 155
Pathway
msb00232  Caffeine metabolism
msb00633  Nitrotoluene degradation
msb01100  Metabolic pathways
msb01110  Biosynthesis of secondary metabolites
msb01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:msb00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    LJ00_01535
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    LJ00_01535
Enzymes [BR:msb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     LJ00_01535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_2
Motif
Other DBs
NCBI-ProteinID: AIU05585
UniProt: I7F580
Structure
PDB: 

Position
337999..338826
Genome map
AA seq 275 aa AA seqDB search
MAMDLSGYLARIGLDGRPRPDLGTLHAIVAAHNRSIPFENLDPLLGIPVADLSAEALSAK
LVDRRRGGYCYEHNGLLGYVLEELGFDVERLSGRVVWMRADDAPLPAQTHNVLSVAVPGA
DGRYLVDVGFGGQTLTSPIRLEAGPVQQTRHEPYRLTRRGDHHTLAAQIRGEWQPLYTFT
TEPRPRIDLEVGSWYVSTHPGSHFVTGLTVAVVTDDARYNLRGRNLAVHRSGATERIRFD
SAAQVLDAIVNRFGIDLGDLAGRDVQARVAEVLDT
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atggcgatggacctcagcgggtatctcgcgcggatcggcctcgacgggcggccgcgtccc
gatctcggcacattgcacgcgatcgtcgcggcccacaaccgctcgatcccgttcgagaac
ctcgatccgctgctcggcatcccggtggccgacctgagtgccgaggccctgtccgccaag
ctcgtggaccgccgccgcggcgggtactgctacgaacacaacggtctgctcggctacgtg
ctggaggaactgggcttcgacgtcgagcgcctgtccgggcgggtggtgtggatgcgggcc
gacgacgcaccactgcccgcccagacccacaacgtgctgtcggtcgcggtgccgggcgcc
gatggccggtacctggtcgacgtgggcttcggcggacagacgctgacctcgccgatccgg
cttgaggccggcccggtgcagcagacccgccacgagccctaccggctcacccggcgtggt
gaccaccacacgctggcggcccagatccgcggtgagtggcaaccgctgtacacgttcacc
accgagccgcggccgcgcatcgacctcgaggtcggaagctggtacgtctcaacacatccg
gggtcacacttcgtcaccgggctcacggtcgcggtggtcaccgacgacgcgcggtacaac
ctgcgggggcgcaacctggcggtccaccggtccggtgcgaccgagcgcatccggttcgac
agcgcggcacaggtgctcgacgccatcgtcaaccggttcggcatcgacctcggcgatctg
gccggccgtgacgtccaggcacgtgtcgccgaggtgctcgacacctga

DBGET integrated database retrieval system