KEGG   Mycolicibacterium smegmatis MC2 155: LJ00_07335
Entry
LJ00_07335        CDS       T03433                                 

Gene name
rpsN
Definition
(GenBank) 30S ribosomal protein S14
  KO
K02954  small subunit ribosomal protein S14
Organism
msb  Mycolicibacterium smegmatis MC2 155
Pathway
msb03010  Ribosome
Brite
KEGG Orthology (KO) [BR:msb00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    LJ00_07335 (rpsN)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:msb03011]
    LJ00_07335 (rpsN)
Ribosome [BR:msb03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    LJ00_07335 (rpsN)
  Bacteria
    LJ00_07335 (rpsN)
  Archaea
    LJ00_07335 (rpsN)
SSDB
Motif
Pfam: Ribosomal_S14 DZR_2 DUF2797 AAA_lid_5 zf_C2H2_13
Other DBs
NCBI-ProteinID: AIU06703
UniProt: A0QSG2
Structure
PDB: 
5XYU 5O5J 5ZEU

Position
1563215..1563400
AA seq 61 aa
MAKKALVHKANKKPKFAVRAYTRCNKCGRPHSVYRKFGLCRICLREMAHAGELPGVQKSS
W
NT seq 186 nt   +upstreamnt  +downstreamnt
atggcaaagaaggcgctggtccacaaggccaacaagaagcccaagttcgcggtccgcgcg
tacacgcggtgcaacaagtgcggtcgcccgcactcggtctaccgcaagttcgggttgtgc
cgcatctgcctgcgcgagatggcgcacgcgggtgagctgcccggcgtgcagaagtccagc
tggtaa

DBGET integrated database retrieval system