KEGG   Mycolicibacterium smegmatis MC2 155: LJ00_07345
Entry
LJ00_07345        CDS       T03433                                 

Definition
(GenBank) 50S ribosomal protein L6
  KO
K02933  large subunit ribosomal protein L6
Organism
msb  Mycolicibacterium smegmatis MC2 155
Pathway
msb03010  Ribosome
Brite
KEGG Orthology (KO) [BR:msb00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    LJ00_07345
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:msb03011]
    LJ00_07345
Ribosome [BR:msb03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    LJ00_07345
  Bacteria
    LJ00_07345
  Archaea
    LJ00_07345
SSDB
Motif
Pfam: Ribosomal_L6 TubC_N
Other DBs
NCBI-ProteinID: AIU06705
UniProt: A0QSG4
Structure
PDB: 
5XYM 5ZET 5O60 6DZP

Position
1563912..1564451
AA seq 179 aa
MSRIGKQPVPVPSGVDVTINGQNLSVKGPKGTLTLDVAEPISVSRAEDGAIVVTRPDDER
RSRSLHGLSRTLIANLVTGVTEGYTQKMEIFGVGYRVQLKGQNLEFALGYSHPVLIEAPE
GITFAVESPTKFSVSGIDKQKVGQISAVIRRLRRPDPYKGKGVRYEGEQIRRKVGKTGK
NT seq 540 nt   +upstreamnt  +downstreamnt
atgtcgcgtattggaaagcagccggttccggttccctccggggtcgatgtgaccatcaat
ggtcagaatctgtcggtcaagggccccaagggcaccctgaccctggacgtcgcagagccc
atctcggtctcgcgtgccgaggacggcgccatcgtggtgacccgtcccgacgatgagcgg
cgcagccgcagcctgcacgggctgtcgcgcacgctgatcgccaacctggtgaccggtgtc
accgaggggtacacgcagaagatggagatcttcggcgtcggttaccgcgtgcagctcaag
ggccagaacctggagttcgcgctgggctacagccatcccgtcctgatcgaggcgcccgag
ggcatcaccttcgcggtggagtcgccgacgaagttctcggtgtcgggcatcgacaagcag
aaagtcggacagatctcggcggtcatccgtcgcctgcgccgtcccgacccgtacaagggc
aagggcgtgcgttacgagggtgagcagatccgccgcaaggtcggaaagacaggtaagtaa

DBGET integrated database retrieval system