KEGG   Mycobacterium smegmatis MC2 155: LJ00_09465Help
Entry
LJ00_09465        CDS       T03433                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
msb  Mycobacterium smegmatis MC2 155
Pathway
msb00071  Fatty acid degradation
msb00072  Synthesis and degradation of ketone bodies
msb00280  Valine, leucine and isoleucine degradation
msb00310  Lysine degradation
msb00362  Benzoate degradation
msb00380  Tryptophan metabolism
msb00620  Pyruvate metabolism
msb00630  Glyoxylate and dicarboxylate metabolism
msb00640  Propanoate metabolism
msb00650  Butanoate metabolism
msb00900  Terpenoid backbone biosynthesis
msb01100  Metabolic pathways
msb01110  Biosynthesis of secondary metabolites
msb01120  Microbial metabolism in diverse environments
msb01130  Biosynthesis of antibiotics
msb01200  Carbon metabolism
msb01212  Fatty acid metabolism
msb02020  Two-component system
Brite
KEGG Orthology (KO) [BR:msb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LJ00_09465
   00630 Glyoxylate and dicarboxylate metabolism
    LJ00_09465
   00640 Propanoate metabolism
    LJ00_09465
   00650 Butanoate metabolism
    LJ00_09465
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LJ00_09465
   00072 Synthesis and degradation of ketone bodies
    LJ00_09465
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LJ00_09465
   00310 Lysine degradation
    LJ00_09465
   00380 Tryptophan metabolism
    LJ00_09465
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LJ00_09465
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LJ00_09465
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LJ00_09465
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:msb04147]
    LJ00_09465
Enzymes [BR:msb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LJ00_09465
Exosome [BR:msb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LJ00_09465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AIU07118
UniProt: I7FHP3 A0QTM4
Position
1975552..1976784
Genome map
AA seq 410 aa AA seqDB search
MASDSSASQVVICNPLRTPVGRMGGVLAALTAADLATSTLRELATRTGLGEGDIDDVVLG
HGYPSGEAPAIGRIAALDAGLGTAVPGLQLDRRCGSGLQAVLYAAGQVATGAAGVVVAGG
AESMSNVEHYALGLRTGVRQGGVALHDRLDRARETAGGTSHPIAGGMIETAENLRREYGI
SRAEQDELAVRSHQRAVAAHDAGRFADELVPVTVPGKRGRPGTVVDRDEHPRADIDVETL
SALRPIRGKVDAEATVTAGNASGQNDGAAMCVVTTREEAEKRGLTPMLALKSWAVTGCAP
EKMGIGPVAASDAALQRAGITLDEVDLIELNEAFAAQVLAVLAEWKVDPLDERLNPNGSG
ISLGHPIGATGARILATAAHEALRRDARYVLETMCIGGGQGLAAVFEAVR
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggcttctgattcgtccgcatcccaggtggtcatctgcaatccgctccgtaccccggtc
gggcggatgggcggtgtgctcgccgcactgaccgccgccgacctcgcgacgtcgacgctg
cgcgaactcgcgacgcggaccggcctcggtgaaggggacatcgacgacgtcgtcctcggc
cacggctacccgagcggcgaggcaccggccatcgggcgcatcgccgcgctcgacgccggt
ctcggcaccgctgtgcccggcctgcagctcgaccgccgctgcggatcgggtctgcaggcc
gtgctgtacgccgccgggcaggtcgccacgggagcggccggtgtggtcgtggccggcggc
gccgagtcgatgtcgaacgtcgagcactacgccctcggcctgcgcaccggtgtccgccag
ggcggtgtggcgctgcacgaccggctcgaccgggcacgtgaaaccgcaggtggcacaagc
catcccatcgccggaggcatgatcgagaccgccgagaacctgcgccgcgagtacggcatc
agccgcgccgaacaggacgaactcgccgtgcggtcgcatcagcgtgcggtcgccgcgcac
gacgcgggccgcttcgccgacgaactcgtcccggtcacggtccccggcaagcggggcaga
cccggcaccgtcgtcgaccgcgacgagcatccccgcgccgacatcgacgtcgagactttg
agcgcgctgcggccgatccgaggcaaggtcgacgccgaggccaccgtcaccgcaggcaac
gcctccgggcagaacgacggtgcggccatgtgcgtcgtgaccacccgcgaagaagccgaa
aagcgcgggctcacacccatgttggcgctcaagtcgtgggcggtcaccgggtgtgcgccc
gagaagatgggcatcggacccgtcgcggccagtgacgcggcgttgcagcgcgctggaatc
accctcgacgaggtggatctcatcgaactcaacgaggcattcgccgcccaggtgctcgct
gtgctcgccgaatggaaggtcgacccgctcgacgaacggctcaaccccaacggatccggc
atctcgctgggccacccgatcggtgccaccggtgcgcggatcctggcgaccgcggcccac
gaggcgctgcggcgcgacgcccgctacgtgctggagaccatgtgcatcggcggcggccag
ggcctcgcggcggtgttcgaggccgtccgatga

DBGET integrated database retrieval system