KEGG   Methylocystis sp. SC2: BN69_0014Help
Entry
BN69_0014         CDS       T02324                                 

Gene name
apaG
Definition
(GenBank) Protein ApaG
  KO
K06195  ApaG protein
Organism
msc  Methylocystis sp. SC2
Brite
KEGG Orthology (KO) [BR:msc00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    BN69_0014 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: CCJ05465
UniProt: J7QNK8
Position
complement(13063..13455)
Genome map
AA seq 130 aa AA seqDB search
MYISITRDIQVTALPDFLPDRSDPDQDRYFWSYTIEIANLGRVRVQLLSRHWIVIDANGR
REEVRGPGVVGEQPVLEPGETFRYASGCPLATPSGMMQGSYRMITDAGETFDVEVPAFSL
DSPLSRPTLN
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgtacatctccatcaccagagacattcaggtcacggcgcttcccgactttctgccggat
cgctcagaccccgaccaggatcgctacttctggtcgtatacgatcgagatcgccaatctc
gggcgcgttcgcgtgcagcttctgtcgcgccactggatcgtgatcgacgccaatgggcgc
cgcgaggaagtgcgcggaccgggcgtcgtcggcgaacagccggtgctggagcctggggag
acgtttcgttacgcctcaggctgtccgctcgccacgccgtcagggatgatgcagggcagc
tatcggatgatcaccgacgccggcgaaaccttcgacgtcgaagtgcccgctttctcgctc
gacagtccgctgtcgcgtccgacgctgaattag

DBGET integrated database retrieval system