KEGG   Methylocystis sp. SC2: BN69_0198Help
Entry
BN69_0198         CDS       T02324                                 

Gene name
pitA
Definition
(GenBank) Phosphate transporter protein
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
msc  Methylocystis sp. SC2
Brite
KEGG Orthology (KO) [BR:msc00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BN69_0198 (pitA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: CCJ05649
UniProt: Q6MZ22
Position
241245..242243
Genome map
AA seq 332 aa AA seqDB search
MQNFSSYLIGLIAVALIFDFLNGLHDAANSIATIVSTRVLRPQFAVAWAAFFNFIAFVFF
GLHVAQTVGAGIVSPNIVDDFVVFGALMGAIVWNLITWGLGIPSSSSHALVGGLVGAGVA
KVGASAIVWDGLLKTSVAIVLSPALGFVLALALILLVSWIFVRRTPGGVDALFRVLQFAS
ASLYSLGHGGNDAQKTMGVIAVLLYSHGALGGEFYVPFWVVIACQAAMGLGTLFGGWRIV
RTMGSRITRLTPVQGFCAETGGAITLFLATALGVPVSTTHTITGAIIGVGASRRVAAVRW
NVAKDIVVAWVITMPMAAFFAATFYALARFAA
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
ttgcagaacttttcatcgtatctgattgggcttatcgcggtcgctctgatcttcgatttc
ctgaacggtctgcacgacgccgccaattcgatcgcgacgatcgtctcgacccgcgttcta
cgtccgcaattcgcagtggcctgggccgccttcttcaactttatcgccttcgtttttttt
gggcttcacgtggcgcaaactgtgggcgcgggcatcgtctcgcctaatatcgtcgatgat
ttcgtggtgttcggcgcgctgatgggggcgatcgtctggaatttgatcacatggggattg
ggcattccgtcctcgagttcgcacgccctcgtcggcggcctcgtgggcgccggcgtggcc
aaggtcggcgcttcggcgatcgtgtgggacggactgctcaagaccagcgtcgcgatcgta
ttatcgccggcgctcgggttcgttctggcgctggcgctgatcctgctcgtgtcctggatc
ttcgtgcgacggacgccgggcggcgtcgatgcgctgtttcgcgtcctgcaattcgcctcg
gcctcgctttattcgctgggccatggcggcaatgacgcgcagaaaaccatgggggtgatc
gcggtgctcctctattcgcatggggccctcggcggcgagttctacgtgcccttttgggtc
gtcatcgcgtgtcaggcggcgatgggccttggcaccttgtttggcggatggcggatcgtg
cgcacaatgggatccaggatcacccgcttaacgccggtgcaaggcttctgcgccgagacg
ggaggcgccatcactctgtttctcgcgacggcgctgggcgttccggtgtcgacgacgcat
acgatcaccggcgcgatcattggcgtgggcgcgtcgcggcgcgtcgcggcggtgcgctgg
aatgtcgcgaaggacatcgtcgtcgcctgggtcatcaccatgccgatggccgcctttttc
gcggcgaccttctatgcgcttgcgaggttcgcggcatga

DBGET integrated database retrieval system