KEGG   Methylocystis sp. SC2: BN69_0238Help
Entry
BN69_0238         CDS       T02324                                 

Definition
(GenBank) Methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
msc  Methylocystis sp. SC2
Pathway
msc00450  Selenocompound metabolism
msc00970  Aminoacyl-tRNA biosynthesis
msc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:msc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BN69_0238
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BN69_0238
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:msc01007]
    BN69_0238
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:msc03016]
    BN69_0238
Enzymes [BR:msc01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     BN69_0238
Amino acid related enzymes [BR:msc01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   BN69_0238
Transfer RNA biogenesis [BR:msc03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BN69_0238
 Prokaryotic type
   Other AARSs
    BN69_0238
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: CCJ05689
UniProt: J7Q3F6
Position
complement(283641..285179)
Genome map
AA seq 512 aa AA seqDB search
MITTAIPYANGAPHIGHAYERIATDAFARWKRLDGYDVLFVTGMDEHGQKMQRTAEKEGL
TPWALADRTAAQFARMGEALNARADDIVRTTQARHKETVLEMWRRMEANGDLYLSKYAGW
YSVRDEAYYDEDELTERDGKKFAPTGTPVEWVEEESWFFKLSAYAEKLLAHYAAHPRFIT
PEHYRNEIVAFVKRGLTDLSVSRTTFDWGIEIPPSAHTAAKHVMYVWVDALTNYVTATGY
LTEGGNKACFWPADAHVIGKDITRFHAIYWPAFLMSAGAPLPKQVVVHGFLFSKGEKMSK
SVGNVVDPIDLAERYGVDQLRYFFLREIPFGQDGNYSHEAIVNRINADLANDLGNLAQRS
LSMIAKNCMGAVPRKHVLTDADNDILAQAADVMAKARAAMEEYAPHHALAEIFRVVAEAN
RYFAGEEPWAKKKSDPARMETILYVTAETLRRLAIPLQPFMPESAGKLLDLLDVGPDARD
FAHADAANALQEGAPLPPPTPVFPRFLEEEAR
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgatcacgacggccattccctatgcgaatggcgcgccgcatatcggccacgcctatgag
cgcatcgccaccgacgccttcgcccgatggaagaggcttgacggctatgacgtgctgttt
gtcaccggcatggacgagcacgggcagaagatgcagcgcacggccgagaaggaagggctg
acgccgtgggcgctcgccgaccgcaccgccgcgcaattcgcgcggatgggcgaggcgctg
aacgcccgcgccgacgacatcgtgcgcacgacgcaggcgcgccacaaagagaccgtgctc
gaaatgtggcggcgcatggaggcgaacggcgacctttatctctccaaatacgccggctgg
tattcggtgcgcgacgaggcctattacgacgaggacgagctcaccgaacgcgacggcaag
aaattcgcgccgacgggcacgccggtcgagtgggtggaggaggagagctggttcttcaaa
ttgtcggcctatgcggagaaattgctggcgcattacgcggcgcatccgcgcttcatcacg
cccgaacactacagaaacgagatcgtcgccttcgtgaagcgcgggctgaccgacctctcg
gtgtcgcgtacgacattcgattggggcatcgagatcccgccgagcgcgcacaccgccgcg
aagcacgtgatgtatgtctgggtcgatgcgcttacgaattacgtaacggctacgggatat
cttacggaaggcggaaacaaggcgtgcttctggcccgccgacgcgcatgtcatcggcaag
gacatcacccgctttcacgccatctactggccggcgttcctgatgtccgcaggcgcgcct
ttgcccaagcaggtcgtcgtccacggcttcctgttctccaaaggcgagaagatgtcgaag
tcggtcggcaatgtcgtcgatccgatcgatttggccgagcgctatggcgtcgaccagctg
cgttatttctttctgcgcgagattcctttcggccaggacggcaattattcgcacgaggcg
atcgtcaaccgcatcaacgccgatctcgccaacgacctcggcaatctcgcgcagcgctcg
ctgtcgatgatcgccaagaattgtatgggcgccgtaccacgtaaacatgtccttacggac
gccgacaacgacattctcgcgcaagcggccgacgtgatggcgaaagcccgcgccgcgatg
gaggaatacgcgccgcaccacgcgctggcggaaattttccgcgtcgtcgccgaggcgaat
cgctacttcgccggtgaagaaccctgggcgaagaagaagagcgaccccgcgcggatggag
acgattctctacgtcaccgccgaaacgctgcgccggctggcgattcccctgcagccgttt
atgcccgaatccgccggcaagcttctcgatctcctggacgtcgggccggacgcgcgggac
ttcgcgcacgccgacgcggcgaacgccctgcaggagggcgcgccgctcccgccgccgacg
ccggtgtttccgaggtttctggaagaggaggcgcgttag

DBGET integrated database retrieval system