KEGG   Methylocystis sp. SC2: BN69_1000Help
Entry
BN69_1000         CDS       T02324                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
msc  Methylocystis sp. SC2
Pathway
msc00071  Fatty acid degradation
msc00072  Synthesis and degradation of ketone bodies
msc00280  Valine, leucine and isoleucine degradation
msc00310  Lysine degradation
msc00362  Benzoate degradation
msc00380  Tryptophan metabolism
msc00620  Pyruvate metabolism
msc00630  Glyoxylate and dicarboxylate metabolism
msc00640  Propanoate metabolism
msc00650  Butanoate metabolism
msc00900  Terpenoid backbone biosynthesis
msc01100  Metabolic pathways
msc01110  Biosynthesis of secondary metabolites
msc01120  Microbial metabolism in diverse environments
msc01130  Biosynthesis of antibiotics
msc01200  Carbon metabolism
msc01212  Fatty acid metabolism
msc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:msc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BN69_1000
   00630 Glyoxylate and dicarboxylate metabolism
    BN69_1000
   00640 Propanoate metabolism
    BN69_1000
   00650 Butanoate metabolism
    BN69_1000
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BN69_1000
   00072 Synthesis and degradation of ketone bodies
    BN69_1000
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BN69_1000
   00310 Lysine degradation
    BN69_1000
   00380 Tryptophan metabolism
    BN69_1000
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BN69_1000
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BN69_1000
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BN69_1000
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:msc04147]
    BN69_1000
Enzymes [BR:msc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BN69_1000
Exosome [BR:msc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BN69_1000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: CCJ06451
UniProt: J7QFP0
Position
complement(1070013..1071203)
Genome map
AA seq 396 aa AA seqDB search
MSAAAPVAIIGAARTPIGAFLGELKDVSAPQLGAQAIEAAVTRAGLAPNDIDEVVMGCVL
SAGLGQAPARQAALGAGLPETTGAVTVNKMCGSGMKAVMLASDQLAVGGARVAVAGGMES
MSNAPYLLDRARTGYRMGHRKALDHMFLDGLEDAYEKGRLMGSFAEDCATEYQFTREMQD
QYAATSLARAQRATSDGSFAQEIAPITLGKGANARAIASDELPGKAKAQDIARLKPAFRE
DGTITAANASAISDGAAALALMRVDEAERAGATPLAVIRGYLTVAGAPSRFSVMPIAAIR
KLMERVGWAANDVDLFEINEAFAVVAMAAMRELDLPHEKVNVRGGACALGHPIGASGARI
IVTLLAALEAKGLKRGVAALCIGGGEATAMAIERPG
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgagcgctgccgcacccgtcgcaattattggcgccgcgcgcacgccgatcggcgcgttt
ctgggagagttgaaggacgtctccgccccgcagctcggcgcgcaggccatcgaagcggcc
gtgacgcgcgccggcctggcgccgaacgacatagacgaagtcgtcatgggctgcgtcctt
tccgcgggccttggccaggccccggcgcggcaggcggcgctcggcgccgggctgccggag
acgacgggcgccgtcaccgtcaataagatgtgcggatctggaatgaaggcggtgatgctc
gcgagcgaccagctcgctgttggcggcgcgcgggtcgcggtcgccggcggcatggagagc
atgagcaacgcgccttatctgctcgatcgcgcgcgcaccggctatcgaatggggcatcgc
aaggcgctcgatcacatgtttctggatgggctggaggacgcctatgaaaagggtcggctg
atgggctccttcgcggaggattgcgcgaccgaatatcaatttacccgcgagatgcaggac
caatatgcggcgacgtcgctggcgcgcgcgcaacgcgcgacgagcgacggctctttcgcg
caggagatcgcgccgataacgctgggcaaaggcgccaacgcgcgcgccatcgccagcgac
gaactgcccggcaaggccaaggcgcaggatatcgcccgcctcaaacccgctttcagggag
gacggcacgatcaccgccgccaacgccagcgcgatatcggacggcgcggcggcgctcgcc
ctgatgcgcgtcgacgaggccgagcgcgccggcgcgacgccgctggccgtcattcgtggc
tatctcaccgtcgcgggcgcgccgagccgcttttccgtcatgccgatcgcagcgatccgc
aaactcatggaacgggtgggttgggcggcgaacgacgtcgacctctttgagatcaatgag
gcgttcgccgtcgtcgccatggcggcgatgcgcgaactcgacttgccgcatgagaaggtg
aatgtccgcggcggcgcctgcgcgctcggccatccgatcggcgcgtcgggcgcacgaatc
atcgtcacgcttctcgccgctctggaggctaagggcctgaaaagaggcgtggcggcgctc
tgcatcggcggcggagaagcgaccgcgatggcgatcgagcggccgggctag

DBGET integrated database retrieval system