KEGG   Methylocystis sp. SC2: BN69_1090Help
Entry
BN69_1090         CDS       T02324                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
msc  Methylocystis sp. SC2
Pathway
msc00040  Pentose and glucuronate interconversions
msc00052  Galactose metabolism
msc00500  Starch and sucrose metabolism
msc00520  Amino sugar and nucleotide sugar metabolism
msc01100  Metabolic pathways
msc01130  Biosynthesis of antibiotics
Module
msc_M00362  Nucleotide sugar biosynthesis, prokaryotes
msc_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:msc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BN69_1090
   00052 Galactose metabolism
    BN69_1090
   00500 Starch and sucrose metabolism
    BN69_1090
   00520 Amino sugar and nucleotide sugar metabolism
    BN69_1090
Enzymes [BR:msc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BN69_1090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Smr NAD_binding_10 HlyU
Motif
Other DBs
NCBI-ProteinID: CCJ06541
UniProt: J7QFT4
Position
complement(1172721..1173605)
Genome map
AA seq 294 aa AA seqDB search
MSKRIRKAVFPVAGLGTRFLPATKAVPKEMLTVVDRPVVQHVVDEAREAGIEHFIFVTGR
GKGAIEDHFDMAYELEDTLRRRNKSKEYEALMSDLPAAGATSFTRQQAPLGLGHAVWCAR
DIIGDEPFAVLLPDMITLPARGKSARCLAEAVAAYETHGGNIIAVEEVKPEETHQYGIVA
RGKDYGATFEITGMVEKPPQGTAPSNFIISGRYILEPEIFALLERHEKGAGGEIQLTDAM
IHLAKTRPFHAVRFDGRTYDTGSKLGFLVANVAFGLARPDVAEGLRAELKKMLD
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaacgcattcgcaaggctgttttccccgtcgccgggctcggcacgcgcttcctg
ccggccaccaaggccgtgcccaaggagatgctgaccgtcgtcgaccgcccggtcgtgcag
catgtcgtggacgaggcgcgagaagccggaatcgagcatttcattttcgtcaccgggcgc
ggcaagggggccatcgaggatcacttcgacatggcctatgagcttgaggacacgctgcgc
cgccgcaacaagtccaaggaatatgaagcgctgatgtcagacctgccagccgcgggcgcg
acgagcttcacccgccagcaggccccgcttggcctcggccacgccgtgtggtgcgcgcgc
gacattatcggcgacgagcccttcgcggtgctgctgcccgacatgatcacgcttcccgcg
cgaggcaaaagcgcgcgctgtctcgcggaagcggtcgcggcttacgaaacacacggcggc
aatatcatcgcggtcgaggaagtgaagccggaagagacgcatcaatacggcatcgtcgcg
cgcggcaaggactacggggcgacgttcgaaatcacagggatggtcgaaaagccgccgcag
gggacggcgcccagcaatttcatcatttccggtcgctatattctggagccggaaattttc
gcgctgctcgaaaggcatgaaaaaggcgccggcggcgaaattcagcttaccgacgccatg
attcatcttgcgaagacgcggcccttccacgccgtgcgcttcgacgggcggacctatgac
acgggttcaaagcttggatttctcgtggccaatgtcgccttcggcctggcgcggccggac
gtcgcggagggcctgcgcgccgagctgaagaagatgctcgattag

DBGET integrated database retrieval system