KEGG   Methylocystis sp. SC2: BN69_1281Help
Entry
BN69_1281         CDS       T02324                                 

Gene name
tuf
Definition
(GenBank) Elongation factor Tu (EF-Tu)
  KO
K02358  elongation factor Tu
Organism
msc  Methylocystis sp. SC2
Brite
Translation factors [BR:msc03012]
 Eukaryotic Type
  Elongation factors
   BN69_1281 (tuf)
 Prokaryotic Type
   BN69_1281 (tuf)
Mitochondrial biogenesis [BR:msc03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    BN69_1281 (tuf)
Exosome [BR:msc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BN69_1281 (tuf)
  Exosomal proteins of breast cancer cells
   BN69_1281 (tuf)
  Exosomal proteins of colorectal cancer cells
   BN69_1281 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: CCJ06732
UniProt: J7Q869
Position
complement(1350535..1351725)
Genome map
AA seq 396 aa AA seqDB search
MAKEKFSRTKPHCNIGTIGHVDHGKTSLTAAITKVLAETGGATFTAYDQIDKAPEEKARG
ITISTAHVEYETQNRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPALVVFLNKVDMVDDPELLELVELEVRELLSKYEFPGDDIPIVKGSALCALE
GKNPEIGHDAILKLMAEVDKYIPQPERPKDQPFLMPVEDVFSISGRGTVVTGRIERGVVK
VGEEVEIVGIRPTTKTTVTGVEMFRKLLDQGEAGDNVGCLLRGTKREDVERGQVLCKPGS
VKPHTKFKAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGIVTLPDGVEMVMPGDNVT
MDVVLIVPIAMEEKLRFAIREGGRTVGAGVVASIIE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggccaaggaaaagttttcacgcacgaagccgcactgcaacattgggacgattgggcac
gtcgaccatggcaagacgtctttgacggcggcgatcaccaaggttctggcggagacgggc
ggggcgacctttacggcctatgaccagatcgacaaggcgccggaagagaaggcgcgcggc
atcaccatttcgacggcgcatgtcgaatatgagacgcagaaccgtcactacgcccacgtc
gactgccccggccacgccgactatgtgaagaacatgatcaccggcgcggcgcagatggac
ggcgcgatcctcgtcgtttcggcggccgacggcccgatgccgcagacccgcgagcatatt
ctgctcgcccgccaggtcggcgtgccggcgctcgtcgtgttcttgaacaaggtcgacatg
gtcgacgatccggagcttctggagctcgtcgagctcgaagtgcgcgagctgctcagcaag
tatgagttcccgggcgacgacattccgatcgtcaagggttcggcgctgtgcgcgctcgag
ggcaagaatcccgagatcggccatgacgcgatcctgaagctgatggcggaggtcgacaaa
tatattccgcagccggagcggccgaaggatcagcccttcctgatgccggtcgaggacgtg
ttctcgatttcgggccgcggcacggtggtgacggggcgcatcgagcgcggcgtggtgaag
gtcggcgaggaagtcgagatcgtcggcatccgtccgacgacgaagacgacggtgacgggc
gtcgagatgttccgcaagctcctcgatcagggcgaggcgggcgacaacgtcggctgcctg
ctgcgcggcacgaagcgcgaggacgtggagcgcggccaggtgctgtgcaagccgggctcg
gtgaagccgcacaccaagttcaaggccgaggcctatatcctcaccaaggaagagggcggc
cgccacacgccgttcttcaccaactaccgtccgcaattctacttccgcacgacggacgtg
accggcatcgtcacgcttcccgacggcgtcgagatggtgatgccgggcgacaatgtgacg
atggacgtcgtgctgatcgtgccgatcgccatggaggagaagctgcgcttcgccatccgc
gaaggcggcagaacggtcggcgccggcgtcgtcgccagcatcatcgagtaa

DBGET integrated database retrieval system