KEGG   Methylocystis sp. SC2: BN69_2128Help
Entry
BN69_2128         CDS       T02324                                 

Gene name
trpB
Definition
(GenBank) Tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
msc  Methylocystis sp. SC2
Pathway
msc00260  Glycine, serine and threonine metabolism
msc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
msc01100  Metabolic pathways
msc01110  Biosynthesis of secondary metabolites
msc01130  Biosynthesis of antibiotics
msc01230  Biosynthesis of amino acids
Module
msc_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:msc00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BN69_2128 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BN69_2128 (trpB)
Enzymes [BR:msc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BN69_2128 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: CCJ07579
UniProt: J7Q4L1
Position
2196576..2197814
Genome map
AA seq 412 aa AA seqDB search
MNKPLPNSFRAGPDENGRFGIFGGRFVAETLMPLVLDLEAAYENAKNDPAFHEELAGLHK
YYVGRPSPLYFAERITDYVRERAGEGKGAKVYFKRDELNHTGAHKINNVLGQILLARRMG
KKRIIAETGAGQHGVATATACARFGLDCVVYMGAVDVERQKPNVFRMKMLGAEVIPVQSG
ARTLKDAMNEALRDWVTNVADTFYCIGTAAGPHPYPAMVRDFQSIIGNETRVQMQEMEGR
LPDSLVACIGGGSNAIGLFHPFLDDASVEIYGVEAAGHGVDVPNGHAASLIGGRPGVLHG
NRTYLLMDDDGQILEGHSISAGLDYPGIGPEHSWLHEIGRVKYLNATDKEALNAFQLCSK
LEGIIPALEPSHALAKVFELAAQKPRDHLMVMNMCGRGDKDIFTVAEHLGGM
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
gtgaacaagccgctacccaattccttccgcgccggcccggatgaaaacggccgcttcggc
attttcggcgggcgtttcgtcgccgaaacgctgatgccgctcgtgctcgatctcgaagcg
gcctatgagaacgccaagaacgacccggcttttcacgaagagctcgccgggcttcacaaa
tattacgtcgggcgtccgtcgccgctctatttcgccgagcgcatcaccgactatgtgcgt
gagcgcgccggcgaaggcaaaggcgccaaggtctatttcaagcgcgacgagctcaaccac
accggcgcgcataagatcaacaatgtgctcgggcagattctgctcgcgcggcgcatgggc
aagaagcgcatcatcgccgagacaggcgccggccagcatggcgtcgccaccgccaccgcc
tgcgcgcgcttcggattggattgcgtcgtctatatgggcgcggtcgacgtcgagcggcag
aagcccaacgtcttccgcatgaagatgctcggcgccgaggtcattcccgtgcagtcgggc
gcgcgcacgctgaaagacgccatgaacgaagcgctgcgcgactgggtgaccaatgtcgcc
gacactttctattgcatcggcacggcggcggggccgcatccctatccggcgatggtgcgc
gacttccagtcgatcatcggtaatgagacgcgcgtgcagatgcaggagatggaggggcgc
ctccccgattcgctcgtcgcctgcatcggcggcggctccaacgccatcggcctgtttcat
ccgtttctcgacgacgccagcgtcgagatctacggcgtcgaagctgcgggccatggcgtc
gacgtgccgaacggccatgcggcctcgctcatcggcgggcgcccgggcgtgctgcacggc
aaccgcacctatctgttgatggatgacgatggccagattctcgaaggccattcgatttcg
gcgggcctcgattatcccggcatcggtcccgaacattcatggctgcatgagatcggccgc
gtgaaatatctgaacgccaccgacaaggaggcgctgaacgcttttcagctctgttcgaag
ctcgaggggatcatcccggcgcttgaaccttctcacgcgctggcgaaagtgttcgaactc
gcggcgcaaaagccgcgcgatcatctgatggtgatgaatatgtgcggccgcggcgacaag
gatattttcacggtcgccgagcatctcggcgggatgtga

DBGET integrated database retrieval system