KEGG   Methylocystis sp. SC2: BN69_2196Help
Entry
BN69_2196         CDS       T02324                                 

Gene name
acsA
Definition
(GenBank) Acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
msc  Methylocystis sp. SC2
Pathway
msc00010  Glycolysis / Gluconeogenesis
msc00620  Pyruvate metabolism
msc00640  Propanoate metabolism
msc00680  Methane metabolism
msc01100  Metabolic pathways
msc01110  Biosynthesis of secondary metabolites
msc01120  Microbial metabolism in diverse environments
msc01130  Biosynthesis of antibiotics
msc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:msc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BN69_2196 (acsA)
   00620 Pyruvate metabolism
    BN69_2196 (acsA)
   00640 Propanoate metabolism
    BN69_2196 (acsA)
  Energy metabolism
   00680 Methane metabolism
    BN69_2196 (acsA)
Enzymes [BR:msc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BN69_2196 (acsA)
Lipid biosynthesis proteins [BR:msc01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BN69_2196 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: CCJ07647
UniProt: J7Q947
Position
complement(2261735..2263663)
Genome map
AA seq 642 aa AA seqDB search
MSQKIYPVSDDWKKRARVDQEAYRRLYERSIKDPDGFWAEQAQRIDWITPFSNVKRTSFD
THNVSIRWFEDGTTNVAMNCIDRHLPARAHQTAIIWEGDDPSVCRHITYAELHEQVCRFA
NVLKKHGVKKGDRVTIYLPMIPEAAFAMLACARIGAVHSVVFGGFSPDSLAGRIADAESK
VIVTADEGLRGGKKIPLKANVDAALDKVSATTVIVVTRTGGEIDMQPGRDFRYEEEAARV
SADCPYAEMDAEDPLFILYTSGSTGKPKGALHTTGGYLVYTSLTHELVFDYREGDVYWCT
ADVGWVTGHSYILYGPLANGATTLMFEGVPNYPSVSRFWEIVDKHKVDIFYTAPTAIRAL
MAAGEAPVKKTSRKSLRLLGSVGEPINPEAWEWYHRVVGEGRCPIVDTWWQTETGGVLIS
PLPGAIDLKPGSATRPFFGVAPEIVDPLGNVLEGACEGLLVISDSWPGQMRTVYGDHERF
AQTYFSAFPGKYFTGDGAKRDSDGDYWITGRVDDVINVSGHRLGTAEVESALVAHEKVSE
AAVVGYPHDIKGQGIYAFVTLNQGVTPSEHLRKELVHWVRHEIGPIATPDIVQFAPGLPK
TRSGKIMRRILRKIAEGEFGALGDTSTLADPGVVEELVKERP
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcaaaaaatctaccccgtctccgatgactggaaaaagcgcgcgcgcgtcgaccaa
gaggcctatcgccggctctacgaacgctccatcaaagacccggacggcttctgggccgag
caggcgcagcgcatcgactggatcacgcccttctcgaacgtgaagcgcacgagcttcgac
acgcataatgtctcgatacgctggttcgaggacggcacgaccaatgtcgcgatgaattgc
atcgaccggcatctgccggcgcgcgcgcatcaaaccgcgatcatctgggagggcgacgat
ccttccgtttgccgccacatcacttacgccgaactgcatgagcaagtctgccgcttcgcc
aatgtgctcaagaaacatggcgtcaaaaaaggcgaccgcgtcaccatctatctgccgatg
attcccgaggccgctttcgccatgctcgcctgcgcgcggatcggcgccgttcattcggtg
gtgttcggcggcttctcgccggactcgctcgcggggcgcattgcggacgctgaatcaaag
gtcatcgtcaccgccgacgaaggcctgcgcggcggcaagaagattccgctgaaagccaat
gtcgacgcggcgctcgacaaggtttccgcgacgacggtcattgtcgtcacgcgcaccggc
ggcgagatcgacatgcagcccggccgcgacttccgctatgaggaagaagccgcgcgcgtt
tccgccgattgtccctatgcggagatggacgcggaagatccgctgttcatcctctatacg
tcaggctcgaccggcaagccgaagggcgcgctgcatacgaccggcggctatctcgtttac
acatcgctcactcatgaactcgtcttcgactatcgtgagggcgacgtctattggtgcacg
gcggatgtgggctgggtgaccggccacagctatattctctacgggccgctcgccaatggc
gcgacgacgctgatgttcgaaggcgtgccgaattatccgagcgtgtcgcgcttctgggaa
atcgtcgacaaacataaggtcgatattttctacacggcgccgaccgccattcgcgcgctg
atggcggcaggcgaagcgccggtgaaaaagaccagccgcaagtcgcttcgtctgctcggc
tccgtcggcgagccgatcaatcctgaagcctgggaatggtatcaccgcgtcgtcggcgag
ggccgctgcccgatcgtcgacacatggtggcagacggaaacgggcggcgtgctgatctcg
ccattgcccggcgcgattgatctgaagcccggctcggcgacgcggcccttcttcggcgtc
gcgcccgaaatcgtcgatccgctcggcaatgttctcgaaggcgcgtgcgaaggcttgctc
gtgatctcggattcatggccggggcagatgcgcaccgtctatggcgatcacgaacgtttc
gcgcagacctatttctccgcttttccgggcaaatatttcaccggcgacggcgccaagcgc
gattctgacggcgattactggatcaccggccgtgtcgacgacgtcatcaatgtctcgggc
catcgcctcggcacggcggaagtcgagagcgcgctcgtcgcgcatgagaaagtgtcggaa
gccgccgtcgtcggctatccgcacgacatcaaggggcagggcatctacgccttcgtcacg
ctcaatcagggcgtgacgccgagcgaacatctgcgcaaggagctggtgcattgggtgcgc
catgagatcgggccgatcgcaacgcccgatatcgtgcaattcgcgccgggcctacccaag
acgcgctccggcaagatcatgcggcgcatcttgcgcaagatcgccgaaggggaatttggc
gcgctcggcgacacctcgacgctggccgatccgggggtggttgaggagctggtgaaggag
cggccgtga

DBGET integrated database retrieval system