KEGG   Methylocystis sp. SC2: BN69_3140Help
Entry
BN69_3140         CDS       T02324                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase)
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
msc  Methylocystis sp. SC2
Pathway
msc00900  Terpenoid backbone biosynthesis
msc01100  Metabolic pathways
msc01110  Biosynthesis of secondary metabolites
msc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:msc00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BN69_3140 (dxr)
Enzymes [BR:msc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     BN69_3140 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXPR_C DXP_redisom_C DXP_reductoisom Sacchrp_dh_NADP NAD_binding_3 NmrA Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: CCJ08591
UniProt: J7QIR8
Position
3230670..3231917
Genome map
AA seq 415 aa AA seqDB search
MALANGQFHAHAPAQPPAPVPRRIVLLGATGSIGRSTVDLLERDPEGFSVSAVAGGRDVE
ALARVARAVGAEFAAIRDESAYAALKAALAGTNTQVAAGREAIIEAALRDADLVVSAIVG
AAGVEPTYAALAAGRDVALANKECLVCAGVPFMRTAAEMGVRLLPMDSEHNAIFQALGGE
DPSCIERMIVTASGGPFRTWSKERIAAASVEEALNHPNWAMGPKITVDSAGMMNKGLELI
EAHHLFGIPAEKLEVVVHPQSIVHGLVAFSDGSVTAGIAVPDMRTPIAHCLGYPDRLTTP
TPRLDLAKIATLTFEAPDFERFPALKLALEVLRAGGGLPTVLNAANEIAVEAFLDRRISF
DGIARHVAEACEAALRDGTANAPATVEDALAVDHIVRERSRSALAGRAASGMLLQ
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atggctttagcaaacggacagtttcacgcccacgctccggcccagccgccggcgccggtc
ccgcgccgcatcgtgctcttgggcgcgacgggctcgatcggccgctcgacggtcgacctt
ctcgaacgcgatccggaaggattctcggtgtcggcggtggcggggggccgcgacgtcgag
gcgctcgcgcgggtcgcccgcgcggtcggggccgaattcgccgccatccgcgacgagagc
gcctatgcggcgctcaaggcggcgctcgccgggaccaacactcaagtcgccgcgggtcgc
gaggcgatcatcgaggccgcgctgcgcgacgccgatctcgtggtctcggcgattgtcggc
gccgccggcgtcgagccgacctacgccgcgctcgccgccggccgcgacgtggcgctcgcc
aataaggaatgtctcgtctgcgccggcgttcccttcatgcggacggcggcggaaatgggc
gtgcggctgctgccgatggacagcgagcacaacgccattttccaggcgcttggcggcgag
gacccctcctgcatcgaacgcatgatcgtcacggcgtccggcggccccttccgcacctgg
agcaaggagcgcatcgccgcggcgagcgtcgaggaggcgctcaatcatcccaattgggcg
atgggcccgaaaataaccgtcgattcggccggcatgatgaacaaggggctcgaactgatc
gaggctcatcatcttttcggcattccggccgaaaagctcgaagtcgtggtccatccgcag
tcgatcgtccacggcctcgtcgcgttttccgacggttcggtgaccgccggaatcgccgtg
ccggacatgcgcacgccgatcgcccactgtctcggctatccagaccggctgacaaccccg
acgccgcgcctcgatctggcgaaaatcgccacgctgacattcgaagcgcctgattttgaa
cggtttccggcgctcaaactggcgctcgaggtcctgcgcgccggcggcggcctgcccacc
gtgctcaacgccgccaatgaaatcgccgtcgaggccttccttgatcgccgcatttccttc
gacgggatcgcgcgccatgtggccgaggcctgcgaggccgcgttgcgcgacggaaccgca
aatgcgcccgccacagttgaggacgccctcgcggtggaccatattgtcagagaaagatca
cgatcggccttggccgggcgtgccgcatcgggcatgctgcttcagtga

DBGET integrated database retrieval system