KEGG   Methylocystis sp. SC2: BN69_3463Help
Entry
BN69_3463         CDS       T02324                                 

Gene name
hisD
Definition
(GenBank) Histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
msc  Methylocystis sp. SC2
Pathway
msc00340  Histidine metabolism
msc01100  Metabolic pathways
msc01110  Biosynthesis of secondary metabolites
msc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:msc00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    BN69_3463 (hisD)
Enzymes [BR:msc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     BN69_3463 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: CCJ08914
UniProt: J7Q5D5
Position
3571834..3573135
Genome map
AA seq 433 aa AA seqDB search
MTLRLDAAAPDFEQRFASLLAMKREASQDVDDTVRGIIEDVVARGDAALVDFSKRFDRID
LEATGIAVSHEEVAAAEAKCSAEQLAALDLALERITAFHERQKPQDLRFRDAAGVELGWR
WTPLDSVGLYVPGGTAAYPSSVLMNVVPAKVAGVKRIVMVVPTPGGHVEPLVLAAAKRSG
IDEIYRVGGAQAVAALAYGTKTIAPVVKIVGPGNAWVAAAKRRVFGQVGIDMIAGPSEVL
ILADATANPDWIAADLLAQAEHDESAQSILITDDASLADSVVAAVERHLSTLSRKEIASA
SWRDYGATIVVKTLADALPLADRIAAEHLEIISEDAEDLAARVSNAGAIFIGAYTPEAVG
DYVGGSNHVLPTARSARFSSGLSVLDFVKRTSILKCDADSLRAIGAAAVTLGDAEGLQAH
ARSVSIRLNQLEA
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgaccttgcgtttggacgccgcggcgcccgatttcgaacagcgtttcgcgtcgctgctg
gccatgaagcgcgaggcgtcgcaggatgtcgacgatacggtccgcggcatcatcgaggac
gtggtcgcccgcggcgacgcggcgcttgtcgacttttccaagcgcttcgaccgcatcgac
cttgaggcgaccggcatcgcggtctcccacgaggaggtcgcggcggcggaagccaaatgt
tccgcggagcagctcgcggccctcgatctggcgcttgagcgaatcaccgccttccatgag
cggcagaagccgcaggatctgcgctttcgggacgccgccggcgtcgagcttggctggcgt
tggaccccgctcgactcggtggggctctacgtgcccggcggcaccgccgcctatccgtct
tccgtgctgatgaatgtcgtgcccgcgaaggtcgcgggcgtgaagcgcatcgtcatggtg
gtcccgacgcccggcggccatgtggagccgctcgtgctcgccgccgccaagcgttcaggc
atcgacgagatctaccgcgtcggcggcgcgcaagccgtggcggcgctggcctatggcacg
aagacgattgcgcccgtcgtcaagattgtcgggccgggcaacgcctgggtggcggcggcg
aagcgccgcgtcttcggtcaggtcggcatcgacatgatcgccggcccctctgaagtgctg
atcctcgccgacgcgaccgccaatcccgactggatcgccgccgatctgcttgcgcaggcc
gagcatgacgaatccgcgcagtcgattctcatcaccgacgacgcctcgctcgccgactcg
gttgtcgccgccgtcgagaggcatctctcgacgctttcgcgcaaggagatcgctagcgcc
tcctggcgcgactatggcgcgacgatcgtcgtgaagacgctcgccgacgcgcttccgctc
gccgaccgcatcgccgcggaacatctcgagatcatcagcgaagacgccgaggacctcgcc
gcgcgcgtttccaacgccggcgccatcttcatcggcgcctatacgccggaagccgtcggc
gactatgtcggcggctcgaatcatgtgctgccgacggcgcgctcggcgcgcttttcgtcg
ggtctgagcgtgctcgacttcgtcaagcgcacgtcgatcctgaaatgcgatgcggattcg
ctgcgcgccatcggcgccgccgcagtgacgctcggcgacgccgaaggcttgcaggcccac
gcgcgttcggtgtcgatccgcctcaatcagctcgaggcgtga

DBGET integrated database retrieval system