KEGG   Methylocystis sp. SC2: BN69_3558Help
Entry
BN69_3558         CDS       T02324                                 

Gene name
gatB
Definition
(GenBank) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
msc  Methylocystis sp. SC2
Pathway
msc00970  Aminoacyl-tRNA biosynthesis
msc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:msc00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BN69_3558 (gatB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:msc03029]
    BN69_3558 (gatB)
Enzymes [BR:msc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     BN69_3558 (gatB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     BN69_3558 (gatB)
Mitochondrial biogenesis [BR:msc03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BN69_3558 (gatB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: CCJ09009
UniProt: J7Q5F4
Position
3670423..3671892
Genome map
AA seq 489 aa AA seqDB search
MTTQAAPNKLISGATGDWEVVIGMEIHAQVTSNAKLFSGASAEYGGAPNDHVSLVDAAMP
GMLPVINEECVKQAIRTGLGLEAKINLRSVFDRKNYFYPDLPQGYQISQYKHPIVGEGAV
IVDVSPSERITVGIERLHLEQDAGKSLHDLSATESHVDLNRSGVALMEIVSKPDLRSAEE
ARAYVSKLRTILRYIGSCDGNMEQGSLRADVNVSVRRPGAPLGTRCEIKNVNSIRFIGQA
IEVEARRQIGILEDGGKINQETRLFDPGRGETRSMRSKEEAHDYRYFPDPDLLPLEFDQP
YVDALRAQLPELPDAKRARFIEQYGLPPYDAGVLVMERAAADYFEQTAKGRDAKLAANWV
INELFGRLNKEGLDVTRSPVSSQALGAIIDLISQNVISGKIAKDLFEIVWTEGGDPKEIV
EARGMKQVTDTGAIEAAIDAVIAANPDKAEQAKAKPTMLGWFVGQVMKQTGGKANPQAVN
ELLKCKLGV
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgacgacacaggcggctcccaacaagctcatcagcggcgcaaccggcgactgggaagtc
gtgatcggcatggagatacatgcgcaggtgacgagcaacgccaagctcttctccggcgcc
tccgcggagtatggcggcgccccgaacgatcacgtctccctggtcgatgcggccatgccg
ggcatgctgccggtcatcaacgaggaatgcgtcaaacaggcgatccgcacaggtctcggc
ttagaggccaagatcaacctgcgttcggttttcgaccgcaagaactatttctatcccgac
ctgccgcagggctaccagatctctcagtataagcacccgatcgtcggcgaaggcgcggtg
atcgtcgacgtatcgcccagcgagcgcatcaccgtgggcatcgagcgtctgcatctcgag
caggacgccggcaagtcgctgcatgatctttcggcgaccgaaagccacgtcgatctcaat
cgcagcggcgtcgcgctcatggagatcgtctccaagcccgacctgcgttcggctgaggag
gcgcgcgcctatgtttcgaagctgcggaccatcctgcgctacatcggctcctgcgacggc
aacatggagcagggttcgctgcgcgccgacgtcaacgtctccgtgcgccgccccggcgcg
ccgctcggcacgcgctgcgaaatcaagaacgtcaactccatccgctttattggccaggcc
attgaagtcgaggcgcgccgtcagatcgggattctcgaggacggcggtaagatcaatcag
gaaacgcggctgttcgatccagggaggggagagacgcgctcgatgcgctccaaggaggaa
gcgcatgactaccggtacttccccgatccggatctgctgccgctcgaattcgaccagccc
tatgtcgacgcgctgagggcgcagttgccggagctgcccgacgccaagcgcgcgcgcttc
atcgaacaatatggcctgccgccgtacgacgccggcgtgctggtgatggagcgcgcggcc
gccgactatttcgagcagacggcgaagggacgcgacgccaagcttgcggccaactgggtg
atcaacgagttgttcggccgtctgaacaaggaggggctcgacgtcacgcgctcgcccgtg
tcgtcgcaggctttgggcgcgatcatcgatctcatttcgcagaatgttatttcgggcaag
atcgccaaggatcttttcgagatcgtctggacggaaggcggcgaccccaaggagatcgtc
gaagcgcgcggcatgaagcaggtgacggacacgggcgccatcgaagccgccatcgacgcc
gtcatcgccgccaaccccgacaaggcggagcaggcgaaggcgaagccgacgatgctcggc
tggttcgtcggacaggtgatgaagcagacgggcgggaaggcgaatccgcaggcggtgaac
gagctgctcaagtgcaagttgggcgtctga

DBGET integrated database retrieval system