KEGG   Methylocystis sp. SC2: BN69_3662Help
Entry
BN69_3662         CDS       T02324                                 

Definition
(GenBank) Phosphopantothenoylcysteine decarboxylase/phosphopantothenate/cysteine ligase
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
msc  Methylocystis sp. SC2
Pathway
msc00770  Pantothenate and CoA biosynthesis
msc01100  Metabolic pathways
Module
msc_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:msc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    BN69_3662
Enzymes [BR:msc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     BN69_3662
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     BN69_3662
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein NAD_binding_7 YjeF_N
Motif
Other DBs
NCBI-ProteinID: CCJ09113
UniProt: J7QTZ4
Position
3769923..3771185
Genome map
AA seq 420 aa AA seqDB search
MAGVGCARSLEAKRVLLIVGGGIAAYKSLDLVRRLRERGARVRVVMTAAAKEFVTPLAFV
SLANEKVYDDLFSTTDEQEMGHIQLSRDADLLVVAPATAHLLARAARGLCDDLATTLLLA
TDKRVLYAPAMNARMWLHPATQRNVSTLHGDGAWFVGPNVGDMACGEYGPGRMSEPLEIV
QAIETALKQDTRLPAPEGLLTRGGALEGLHVVVTSGPTHEPIDPVRYIANRSSGRQGHAI
AAAAARAGARVTLISGPVVLSDPPGCETIHIESARDMLTAAEAALPADIFVAAAAVADWR
AEPAVDKIKKGARGAPSLSLVENPDILARVSRGPNRPRLVVGFAAETRDLIRHAQEKLAR
KGCDLIVANDVSEGTGVFGGATNEAHLVSRGGVEDWPRLRKEDLAERLVARLAQMIGEAS
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
gtggcgggcgtgggttgtgcgcggagcctcgaggctaagcgcgtcttgctgatcgtgggc
ggggggatcgccgcgtataaatcgctcgatctcgtgcggcgcctgcgtgagcgcggcgcg
cgggtgcgcgtcgtcatgacggcggcggccaaggagttcgtgacgcctctcgccttcgtc
agcctggcgaatgaaaaagtctatgacgatctcttctccacaaccgacgagcaagagatg
ggccatattcagctgtcacgcgacgccgaccttctcgtcgtcgctcccgcgacggcgcat
ctcctggcgcgcgcggcgcgcggactctgcgacgatcttgcgactaccctgctgctcgcg
accgacaagcgcgttctttatgcgccggcgatgaatgcgcgcatgtggcttcaccccgca
acccagcgaaacgtctcgacgctgcacggcgacggcgcctggtttgtcggcccaaacgtc
ggcgacatggcctgcggcgaatatgggcccgggcgcatgagcgagccgctggagatcgtt
caagcgatcgagacggcgctgaagcaggatactcggctgcccgcgcccgaaggcctgctg
acgcgcggcggcgcgctcgaagggctgcatgtcgtcgtgacctccgggcccacccatgag
ccgatcgatccggttcgctacatcgccaatcgttcctcagggcggcaggggcacgccatc
gccgcggcggcggcgcgcgcaggggcgcgtgtgacgttgatctcagggccggtcgtcctc
tcggatccgccgggctgcgagacgatacatatagagagcgcgcgagacatgctgaccgcc
gcagaggccgcgcttccggcggatatattcgtcgccgcagcggccgtcgccgattggcgc
gcggagccggcggtcgacaagatcaagaagggcgcgcgcggcgcgccgagcctgtcgctc
gtcgaaaatcccgacattcttgcgcgcgtctcacgcggaccgaaccgtccgcgcttggtc
gtcggcttcgccgcggaaacgcgcgaccttatccgccacgcgcaggaaaagctcgcccga
aaaggatgcgatctcatcgtcgccaacgacgtcagcgaggggaccggcgtatttggcggg
gccacgaatgaggcgcatctcgtctcgcgagggggcgtcgaagactggccgcggcttcgc
aaggaggacctcgccgagcggctcgtggcgcgcctcgcgcagatgatcggcgaagcgtca
tga

DBGET integrated database retrieval system