KEGG   Myxococcus stipitatus: MYSTI_01850Help
Entry
MYSTI_01850       CDS       T02436                                 

Definition
(GenBank) 8-amino-7-oxononanoate synthase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
msd  Myxococcus stipitatus
Pathway
msd00780  Biotin metabolism
msd01100  Metabolic pathways
Module
msd_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:msd00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    MYSTI_01850
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:msd01007]
    MYSTI_01850
Enzymes [BR:msd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     MYSTI_01850
Amino acid related enzymes [BR:msd01007]
 Aminotransferase (transaminase)
  Class II
   MYSTI_01850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AGC43182
UniProt: L7U6F2
Position
complement(2284824..2285915)
Genome map
AA seq 363 aa AA seqDB search
MLDFTSSLYLGLVHASRTLEPWEQLTLGAPAVVEEPASVARTERDLAELVGCDRALLSRS
TLHVFWDVFSGLEGRRVSLFWDDGAYPIAKWGIETMAARGVPARGFHHHSPESLARRILS
LDPGRLPVVVCDGWCPGCGELAPLEAYLDLVRAHGGLLIVDDTQAVGVLGRRHRGLPLGV
GGGGSLRWEGLQGPDLLWCGSLAKALGVPMAAVAGDARVVARIEARGETRVHCSPPSVAD
LHAAQRALAINHREGDALRRALAQRVAHFRERLRLAGLSALGGPFPVQRVLLPSGVDSRR
VHERLRHKGVRTVLQRSRCGPEVSVSFILTTRHGAPELTQAVDLLTEALHDEHHERTRHE
RVA
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
gtgctcgacttcacctcctcgctctacctggggctggtgcatgccagccggacgctcgag
ccctgggagcagctcaccctgggcgcgcccgccgtcgttgaagagcccgcctccgtggcc
aggacggagcgcgacctggcggagctggtgggctgtgaccgcgcgctgctctcccggtcc
acgctgcatgtgttctgggatgtgttcagcgggctggaggggcgccgtgtctccttgttc
tgggacgacggcgcctatccgatagcgaagtggggcatcgagaccatggccgcgcgaggc
gttcccgcgcgcgggttccaccaccactcgcccgagagcctggcgcggagaatcctctcg
ttggacccggggcgcctgccggtggtggtctgcgatggctggtgtccgggctgcggggag
ctggcgccgctcgaggcgtacctggacctggtccgtgcgcatggagggctgctcatcgtc
gatgacacccaggccgtgggcgtgctcgggcgacggcacaggggcttgccgctgggggtg
ggcggtgggggctcgctgcgatgggaagggcttcaagggccggatctcttgtggtgcggc
tccctggcgaaggcgttgggggtgcccatggcggcggtggcgggggatgccagggtggtg
gctcgcatcgaggcacgcggagagacgcgtgtgcattgcagtccaccgtcggtcgcggac
ctgcatgccgcgcagcgggccctcgccatcaatcatcgggagggggacgcccttcgccgc
gcgctggcccagcgtgtggcccacttccgcgagcgactgcggcttgcggggctgagcgcc
ctgggcgggccgttccccgtgcagagggtgctgctgccctcgggggtggactcgcgccgg
gtccacgagcggctgcggcacaagggcgttcgcaccgtgctccagcgctcacgctgcggg
ccggaggtttcggtgagcttcatcctcacgacccggcacggcgcgccggagctgacccaa
gccgtggacctcctgaccgaggcgctccacgacgaacatcacgagaggacacgtcatgaa
cgagtggcatga

DBGET integrated database retrieval system