KEGG   Myxococcus stipitatus: MYSTI_03168
Entry
MYSTI_03168       CDS       T02436                                 

Definition
(GenBank) hypothetical protein
  KO
K11892  type VI secretion system protein ImpK
Organism
msd  Myxococcus stipitatus
Pathway
msd03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:msd00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    MYSTI_03168
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:msd02044]
    MYSTI_03168
Secretion system [BR:msd02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   MYSTI_03168
SSDB
Motif
Pfam: DotU
Other DBs
NCBI-ProteinID: AGC44482
UniProt: L7UA86
Position
complement(4003194..4003832)
AA seq 212 aa
MKLTHWKAILLAYRHVDDTLARELGPANLDPAYRDHLSPGAMDALSRDLVVEVEKLRIAL
GTDLRSDDVEKVLQPFAFLLDEKVLGRLANDDAQHWPLLQLRVFGLDSGGDLFYELADTC
LRRQDTAPLLFEMLHFCLTAGFTGRYVGHPARLREYREQLVARIPRPEAVAPQVATEEAA
PPPTLYDFPWRYYAVTLAIIVALPVVLWHLSN
NT seq 639 nt   +upstreamnt  +downstreamnt
atgaagctgacgcactggaaggccatcctcctggcctaccgccatgtggacgacaccctg
gcgcgcgagctgggcccggcgaacctggacccggcctaccgcgaccacctgtctccgggc
gcgatggacgcgctgtcgcgcgacctggtcgtcgaagtcgagaagctccgcatcgccctg
ggcacggacctgcgctccgacgacgtggagaaggtgctgcagccgttcgcgttcctcctg
gacgagaaggtgctcgggcggctggcgaacgacgacgcccagcactggccgctcttgcag
ctgcgcgtgttcggcttggactccggcggagacctcttctacgagctggccgacacgtgc
ctgcgccggcaggacacggcgcccctgctcttcgagatgctgcacttctgcctcaccgcg
ggcttcacgggccggtatgtcggccaccccgcgcggctgcgcgagtaccgcgagcagctg
gtggcgcgcatcccccgcccggaggccgtcgcgccccaggtggcgaccgaggaagccgcc
ccgccgcccacgctgtacgacttcccctggcgctactacgcggtgacgctcgccatcatc
gtcgcgctgcccgtggtgctctggcacctctccaactga

DBGET integrated database retrieval system