KEGG   Myxococcus stipitatus: MYSTI_03172Help
Entry
MYSTI_03172       CDS       T02436                                 

Definition
(GenBank) Gpw/Gp25 family protein
  KO
K11905  type VI secretion system protein
Organism
msd  Myxococcus stipitatus
Brite
KEGG Orthology (KO) [BR:msd00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:msd02044]
    MYSTI_03172
Secretion system [BR:msd02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   MYSTI_03172
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GPW_gp25 PDCD9
Motif
Other DBs
NCBI-ProteinID: AGC44486
UniProt: L7U6K1
Position
complement(4007770..4008171)
Genome map
AA seq 133 aa AA seqDB search
MGRASFLDKFASRGSSVRSGSRQGGNELEHVLRNLEAVLNTKAGYGFFRRDFGLGEYTEK
YGTRELVETLTRELREEIANHEPRLSHVELTMRGRDAGLWLHFGLVGTVAGERHKLRLRF
DTLSGHVRVEVEP
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atggggcgcgcatccttcctcgacaagttcgccagccgcggcagcagcgtccgctcgggc
tcgcgccagggtggcaacgagctggagcacgtgctgcgcaacctggaggccgtgctcaac
accaaggcgggctacggcttcttccgccgcgacttcggcctgggtgagtacacggagaag
tacggcacgcgcgagctggtggagacgctcacccgcgagctgcgtgaagagattgcgaac
cacgagccgcgcctgtcccacgtggagctgacgatgcgcgggcgcgacgcgggcctgtgg
ctccacttcggcctggtgggcaccgtggccggggagcgtcacaagctgcgcctgcgattc
gacacgctcagcggacatgtccgcgtggaggtggagccatga

DBGET integrated database retrieval system