KEGG   Myxococcus stipitatus: MYSTI_03691Help
Entry
MYSTI_03691       CDS       T02436                                 

Definition
(GenBank) hydroxymethylglutaryl-CoA synthase
  KO
K01641  hydroxymethylglutaryl-CoA synthase [EC:2.3.3.10]
Organism
msd  Myxococcus stipitatus
Pathway
msd00072  Synthesis and degradation of ketone bodies
msd00280  Valine, leucine and isoleucine degradation
msd00650  Butanoate metabolism
msd00900  Terpenoid backbone biosynthesis
msd01100  Metabolic pathways
msd01110  Biosynthesis of secondary metabolites
msd01130  Biosynthesis of antibiotics
Module
msd_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:msd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    MYSTI_03691
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    MYSTI_03691
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MYSTI_03691
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MYSTI_03691
Enzymes [BR:msd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.10  hydroxymethylglutaryl-CoA synthase
     MYSTI_03691
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG_CoA_synt_N HMG_CoA_synt_C ACP_syn_III Chal_sti_synt_N Thiolase_N
Motif
Other DBs
NCBI-ProteinID: AGC44997
UniProt: L7UBP7
Position
complement(4682849..4684111)
Genome map
AA seq 420 aa AA seqDB search
MKKRVGIEALAVAVPSRYVDIEDLARARGVDPAKFTSGLGAREMAVTDPGEDTVALAATA
AARLIQQQGVDTSRIGMLVVGTETGIDHSKPVASHVQGLLKLPRTMRTFDTQHACYGGTA
GLMAATEWIASGAGAGKVAIVICSDIARYGLNTAGEPTQGGGAVALLVSEQPDLLALDVG
LNGTCTMDVYDFWRPVGRREALVDGHYSINCYLEALSGAYRGWREKALEHGLVRWSGTMP
GEQLARIAYHVPFCKMARKAHTQLRLCDLEDAVGPGPGTPEAREEVAKSSASYDAQVATS
LGLNSRIGNVYTASLYLALAGLLQREGAQLASQRIGLLSYGSGCMAEFYSGVVGEKAAER
MARADLEGVLARRERVSIEEYERLMKLPSDSPEAKAPAPGTFRLAEIRDHKRIYVEGGAA
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagcgggttggaatcgaggcgctggcggtcgcggtgccgtcgcggtacgtggac
atcgaggacctggcgcgggcgcggggcgtggacccggcgaagttcacctcgggcctgggt
gctcgggagatggccgtcacggacccgggtgaggacacggtggcgctggccgcgacggcg
gccgcccggctcatccagcagcaaggcgtggacacgtcgcgcatcggcatgctcgtggtg
ggcaccgagacgggcatcgaccactcgaagcccgtggcctcacacgtccagggcctgctg
aagctgccgcgcaccatgcgcaccttcgacacgcagcacgcgtgctacggcggcaccgct
ggactgatggccgcgacggagtggattgcgtcgggcgcgggcgcgggcaaggtggccatc
gtcatctgttcggacatcgcgcgctacggcctcaacaccgcgggcgaacccacgcagggc
ggcggcgcggtggcgctgctcgtctccgagcagccggacctgctcgcgctggacgtgggc
ctcaacggcacgtgcaccatggatgtctacgacttctggcggcccgtcggccggcgggag
gcgctggtggacgggcactactccatcaactgctacctggaggcgctgtcgggggcctac
cggggctggcgcgagaaggcgctggagcacgggctggtgcgctggtccggcacgatgccc
ggcgagcagctcgcgcgcatcgcctaccacgtccccttctgcaagatggcgcgcaaggcg
cacacgcagcttcggctctgcgacctggaggacgcggtgggcccgggccccggcacgccc
gaggcgcgcgaggaagtggcgaagtcctccgccagctatgacgcgcaggtggccacgtcg
ctggggctgaactcgcgcatcggcaacgtctacaccgcctcgctgtacctggccctggcg
gggctgctccagcgcgaaggggcgcagctcgcctcgcagcgcatcggcctgctgtcctac
ggcagcggctgcatggcggagttctactccggcgtcgtcggcgagaaggccgcggagcgg
atggcccgcgcggacctggagggcgtgctggcccgacgcgagcgcgtgtccatcgaggag
tacgagcggctgatgaagctgccctcggactcgcccgaggccaaggctccggcgcccggc
accttccgcctcgcggagattcgcgaccacaagcgcatctacgtcgagggcggcgcggcg
tga

DBGET integrated database retrieval system