KEGG   Myxococcus stipitatus: MYSTI_04819Help
Entry
MYSTI_04819       CDS       T02436                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
msd  Myxococcus stipitatus
Pathway
msd00071  Fatty acid degradation
msd00072  Synthesis and degradation of ketone bodies
msd00280  Valine, leucine and isoleucine degradation
msd00310  Lysine degradation
msd00362  Benzoate degradation
msd00380  Tryptophan metabolism
msd00620  Pyruvate metabolism
msd00630  Glyoxylate and dicarboxylate metabolism
msd00640  Propanoate metabolism
msd00650  Butanoate metabolism
msd00900  Terpenoid backbone biosynthesis
msd01100  Metabolic pathways
msd01110  Biosynthesis of secondary metabolites
msd01120  Microbial metabolism in diverse environments
msd01130  Biosynthesis of antibiotics
msd01200  Carbon metabolism
msd01212  Fatty acid metabolism
msd02020  Two-component system
Module
msd_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:msd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MYSTI_04819
   00630 Glyoxylate and dicarboxylate metabolism
    MYSTI_04819
   00640 Propanoate metabolism
    MYSTI_04819
   00650 Butanoate metabolism
    MYSTI_04819
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MYSTI_04819
   00072 Synthesis and degradation of ketone bodies
    MYSTI_04819
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MYSTI_04819
   00310 Lysine degradation
    MYSTI_04819
   00380 Tryptophan metabolism
    MYSTI_04819
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MYSTI_04819
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MYSTI_04819
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    MYSTI_04819
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:msd04147]
    MYSTI_04819
Enzymes [BR:msd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MYSTI_04819
Exosome [BR:msd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MYSTI_04819
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Peptidase_M22
Motif
Other DBs
NCBI-ProteinID: AGC46109
UniProt: L7UI29
Position
6183456..6184610
Genome map
AA seq 384 aa AA seqDB search
MRPCAVIGVGQSRHASRRDDVSLAGLVREAVDRALADAALTLEDIDAVVLGKAPDMFEGV
MMPELYLADCLGAGNKPLLRVHTAGSVGGSTAIMAVNLVRAGLHSRVLAVAFEKQSESEA
MWALSPKYPFQPPLLAGAGGYFAPLVRAYIRRSGAPQDVGIRVAVKDRKHALLNPYAHLH
LPDISTEAVASSAMLWDPLRYLETCPSSDGACAMVLTSEDAARHAPGPVAWVRATAMRSE
PTLFAGRDQVNPQAGRDCAAALYKLAGITSPRREIDVAELYVPFSWFEPMWLENLGFAEP
NEGWRMTAEGATALGGALPVNPSGGVLSTNPIGASGMLRFAEAALQVRGLAGEHQVDGAK
VALGHAYGGGSQFFSMWIVARQQL
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgaggccctgcgcggtcatcggcgtggggcagagtcggcacgcctcccggcgcgacgac
gtgtccctcgcggggctcgtgcgcgaggccgtggaccgtgccctcgctgacgcggcgctg
acgctcgaggacatcgacgccgtggtgctcggcaaggcgcccgacatgttcgagggcgtg
atgatgccggagctgtacctcgccgactgtctcggcgcggggaacaagccgctgcttcgt
gtgcacaccgccgggagcgtcggcggctccacggccatcatggccgtgaaccttgtccgc
gcgggcctccactcacgcgtcctcgccgtggccttcgagaagcaatccgagagcgaggcc
atgtgggccctctccccgaagtaccccttccagcctcccctgctcgccggagcgggcggc
tacttcgctccgctcgtgcgcgcctatatccgccgctcgggcgccccgcaggacgtcggc
atccgagtcgccgtcaaggaccgcaagcacgcgctgctcaacccctacgcccacctgcac
ctgcccgacatctccaccgaggccgtggcgagctcggcgatgctctgggacccgctgcgc
tacctcgagacctgtccttcgtccgatggcgcctgcgcgatggtgctcaccagcgaggac
gccgcgcgacacgcccccggccccgttgcatgggtacgcgccacggccatgcgcagcgaa
cccaccctgttcgccggccgggaccaggtgaatccccaagcaggcagagactgcgccgcc
gccctctacaagctcgccggaatcacctcgccgcgcagggagatcgacgtcgccgagctc
tatgtccccttctcctggttcgagcccatgtggctggagaacctcggcttcgcggagccg
aacgagggctggcgcatgaccgccgagggcgcaacggcgctcggaggagcgctgcccgtc
aatccctccggcggcgtcctctcgaccaaccccatcggtgcctccggaatgctgcgcttc
gccgaggccgcgctccaggtccgaggcctcgccggcgaacatcaggtggacggagcgaag
gtcgcactgggccacgcctacggcggcggctcgcagttcttctcgatgtggatcgtggca
cgtcagcagctctag

DBGET integrated database retrieval system