KEGG   Myxococcus stipitatus: MYSTI_06663Help
Entry
MYSTI_06663       CDS       T02436                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
msd  Myxococcus stipitatus
Pathway
msd00020  Citrate cycle (TCA cycle)
msd00310  Lysine degradation
msd01100  Metabolic pathways
msd01110  Biosynthesis of secondary metabolites
msd01120  Microbial metabolism in diverse environments
msd01130  Biosynthesis of antibiotics
msd01200  Carbon metabolism
Module
msd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
msd_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:msd00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MYSTI_06663
  Amino acid metabolism
   00310 Lysine degradation
    MYSTI_06663
Enzymes [BR:msd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     MYSTI_06663
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: AGC47936
UniProt: L7UG61
Position
8583958..8585172
Genome map
AA seq 404 aa AA seqDB search
MAVELKVPPLGESITEAVVGKWNKKAGDAVTADEPLVVLETDKVTIDVPAPAAGSLASVA
FKEGDKVRVGDVLGLIEAGAGAPAAKPAAAAPAAPAPAPVAAAAEASGGSDARITPTARK
MAEENKLDVSQLKGSGTAGRITKEDVLGQLNRPTAPSQPAAPATPAGPRPNAAREERVRM
TPLRKRVAERLVQAQSTAALLTTFNEVDMGEVMALRKKYNDKFLAKHGVKLGFMSFFVRA
SIEALKAFPQVNGEIDGEDVIFKHYYDIGVAVSGSRGLVVPVLRNADKLSLAELEKGVAD
LGTRARNDKLGLADLQGGTFTITNGGIFGSMLSTPIINPPQTGILGMHNIVERPVVRDGQ
IVIRPIMYVALTYDHRLIDGREAVQFLVRVKECIEDPERLLLDV
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggccgttgaactgaaagtgccccccctgggtgagtccatcaccgaggccgtcgtcggc
aagtggaacaagaaggccggtgacgcggtgacggcggacgagccgctcgtcgtccttgag
accgacaaggtcaccatcgacgtgcccgctcccgcggccggctccctggccagcgtcgcc
ttcaaggagggcgacaaggtgcgcgtgggtgacgtgctcggcctcatcgaggccggtgcc
ggcgctcccgccgccaagcccgccgccgctgctcccgccgccccggctccggctcccgtg
gccgccgccgcggaggcctcggggggctcggatgcccgcatcacgccgacggcccggaag
atggcggaggagaacaagctggacgtctcccagctgaagggcagcggcaccgcgggccgc
atcaccaaggaggacgtgctcggccagctcaaccgcccgaccgcgccctctcagcccgcc
gccccggccacgcccgcgggcccccgccccaacgccgcccgcgaggagcgcgtgcgcatg
acgccgctgcgcaagcgcgtcgcggagcgcctggtccaggcccagtccaccgccgccctg
ctcaccaccttcaacgaggtggacatgggcgaggtgatggccctgcgcaagaagtacaac
gacaagttcctcgcgaagcacggcgtgaagctgggcttcatgagcttcttcgtccgcgcg
tccatcgaagccctcaaggccttcccgcaggtgaacggggagattgacggcgaggacgtc
atcttcaagcactactacgacatcggagtggcggtgagcggcagccgcggcctggtcgtc
cccgtgctgcgcaacgcggacaagctgtccctggcggagctggagaagggcgtcgcggac
ctgggcacccgggctcgcaacgacaagctgggcctggcggacctccagggcggcaccttc
accatcaccaacggcggcatcttcggctccatgctgtccacgcccatcatcaacccgccg
cagacgggcatcctgggcatgcacaacatcgtggagcgccccgtcgtgcgcgacgggcag
attgtcatccgccccatcatgtacgtcgccctcacctacgaccaccggctgattgacggc
cgcgaggccgtccagttcctcgtgcgcgtcaaggagtgcatcgaggacccggagcgtctg
ctgttggacgtctga

DBGET integrated database retrieval system