KEGG   Metallosphaera sedula: Msed_0267Help
Entry
Msed_0267         CDS       T00509                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mse  Metallosphaera sedula
Pathway
mse00010  Glycolysis / Gluconeogenesis
mse00620  Pyruvate metabolism
mse00640  Propanoate metabolism
mse00680  Methane metabolism
mse00720  Carbon fixation pathways in prokaryotes
mse01100  Metabolic pathways
mse01110  Biosynthesis of secondary metabolites
mse01120  Microbial metabolism in diverse environments
mse01130  Biosynthesis of antibiotics
mse01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mse00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Msed_0267
   00620 Pyruvate metabolism
    Msed_0267
   00640 Propanoate metabolism
    Msed_0267
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Msed_0267
   00680 Methane metabolism
    Msed_0267
Enzymes [BR:mse01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Msed_0267
Lipid biosynthesis proteins [BR:mse01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Msed_0267
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ABP94444
UniProt: A4YDE2
Position
complement(224544..226370)
Genome map
AA seq 608 aa AA seqDB search
MIWKPDKEWREESNIGKWLAERNQSLDQFQEFTWKEPETFWPSFLERVGVNFRRKPEKVL
DLSRGREWSKWFVGSRLNVTDQLDDSPETLVSSMNEEGEVKEFSRSQVLSWAKSISSWLR
RAGLSPGDRVAVYMPMTAEIVPIMLGIARAGMIIVPLFSGYGEEPIRVRVEDSGAKAIFT
VDRYTRKGKRVEPTRNLERLNLVKIALKTSLELKDYHDLRELTREGGDGYEETEAESPLM
IIYTSGTTGKPKGCVHVHGGFPVKASADMYFHFDVRKGEGVSWISDMGWMMGPWLVFGSL
MVGARMALLDGYATPETLENFVNTLRVNVLGLSASLIRSLRSSKPSMKLDVRVVGNTGEP
IDPESWNWIAQVTESPVINYSGGTEISGGILGNYVVKEMRPSSFNGQSPGIRAEVFNESG
EPANPGEEGELVVLSVWPGMTRGFWKDPGRYIETYWSRWKNVWVHGDLAIKDEDGYFYIV
GRSDDTIKVSGKRIGPGEIEAVLNAHRAIVESACVGVPDPTKGEKVICLAVPKEVRTGLE
EELLKYLEERLGKAIAPSIVKLVPELPKTRNAKIMRRLIRNTILNKDLGDISSLENPQSL
ELIKKALS
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
ttgatatggaagcctgacaaggaatggagggaagagagcaatatagggaaatggttagct
gaaaggaaccagtccctggatcagttccaggaattcacatggaaggaacctgaaaccttt
tggccttcctttctagaaagagtcggggttaatttcaggaggaaacccgagaaggttctg
gacctctctcgaggaagagaatggtccaagtggttcgtaggatctaggttaaacgttaca
gatcagctggatgattcccctgaaactctggtctcttccatgaatgaggagggagaagtt
aaggagttcagtcgctcccaggtcctgagctgggctaaatccatatccagctggttgagg
agagctgggctgtccccaggggatagggtggccgtgtacatgcccatgacagctgagata
gttcccattatgctggggatagctagggcagggatgattattgtcccgctattctcaggg
tatggagaggaaccaattcgagttagggtggaggatagcggagctaaggcaatcttcact
gtagataggtacacaagaaaggggaaacgggtggaaccgactaggaacctggagagactc
aatctcgtaaagatagccctgaaaacttccctagagctaaaggattatcacgacttaagg
gagttaaccagggaaggaggagacggatacgaggaaactgaggcggagagtcccctaatg
ataatttacacttcaggtaccaccgggaaaccaaagggatgtgttcacgttcacggtggc
tttccagtgaaggcgtcagcggacatgtacttccattttgacgtgaggaaaggagagggt
gtttcctggatttcagacatgggatggatgatgggaccgtggttagtgtttggctctctg
atggtgggagcgagaatggctctcctcgacggttacgcaacccccgaaaccctggaaaac
ttcgtgaacaccttgagggtaaacgtcctaggtctatcagccagcctaatcaggagcttg
aggtcgtctaagccgtccatgaagctggatgtgagggtcgtggggaacaccggtgaaccc
atagatcctgagagctggaactggattgcccaggttacggagtccccagtgattaattac
tctggtggcacggagatctccggaggaatactggggaactacgttgtcaaggagatgagg
ccctcctcctttaacgggcaatctccaggaataagggctgaggtcttcaacgagagtggc
gaacctgctaatccgggcgaggagggggagctggtggtgctgagcgtttggcccggaatg
accagggggttctggaaggatccaggcaggtacattgaaacctactggtctagatggaaa
aacgtttgggttcacggggatctagccataaaggatgaggacggttacttctacatcgtg
ggaaggagcgacgataccataaaggtctcagggaaaaggataggtccaggggagatagag
gcagttctcaatgcccatcgagctatcgtggagagtgcatgtgttggtgtccctgatcct
acgaagggagagaaggtgatatgcctagcagtacctaaggaggttaggactggactcgag
gaggagttactgaaataccttgaggagaggttggggaaggcaatagctccctccatcgtg
aaactagtccctgaactgccaaaaaccaggaacgcgaagatcatgaggaggctcataagg
aacacgatactcaacaaagatctaggagatatatcctccctcgaaaatcctcagtcccta
gagctcataaaaaaggcgctgtcttga

DBGET integrated database retrieval system