KEGG   Metallosphaera sedula: Msed_1528
Entry
Msed_1528         CDS       T00509                                 

Name
(GenBank) protein of unknown function DUF214
  KO
K02004  putative ABC transport system permease protein
Organism
mse  Metallosphaera sedula
Brite
KEGG Orthology (KO) [BR:mse00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mse02000]
    Msed_1528
Transporters [BR:mse02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Putative ABC transporter
    Msed_1528
SSDB
Motif
Pfam: MacB_PCD FtsX
Other DBs
NCBI-ProteinID: ABP95684
UniProt: A4YGY2
Position
complement(1489135..1490364)
AA seq 409 aa
MKLSDVVNFSFKALTSKKLRTSLTILGILIGPAIVVGLTGLTLGFSSVLTHQLFSSLSPT
DIFVTPGTSTITPYTIQEISHIPGVKAVVPFYLISGTIETPSGPMATEILSISTSQASEV
FPGLTLQQGQYPSPYSSYGAVVGYYIAHPQYPGQPTYQVGQTITVVMNTPNGKITKTFLV
TGSFNEFSSAFADIDKALVVQNIVGSQYYGDQYSGLIVEASSVSQVNNVVNSIHNELGRS
VSVTSVEQFITLINNSLSAVNGLLFVAGASSFIVAFVGILSTMFTTVVERTREIGVLRAI
GFTRRGIMVIFVTEAILMGLLGGTAGVGAGVGMGYLLTTLTNSGGPGAGRGSAAASGGLG
ISAHITPVFEPTFIAEVILITVIFSLFAGIIPAYRASRIEPAVALRYEV
NT seq 1230 nt   +upstreamnt  +downstreamnt
atgaaactttcagatgttgtgaacttttcctttaaagccttaacctcgaagaagctaaga
acgagcttaacaatcttaggaatacttattgggccagctatagttgtgggattaacgggt
ctaaccctaggattttcctcggttctaactcatcagctcttctccagtctatctcctacc
gacatctttgtgactccgggtacaagcacaattaccccctataccatacaggagatatca
cacataccaggagttaaggcagtagttccgttttatcttatctctggtacaattgaaacg
cctagtggtcctatggctacagaaattctctctattagcactagccaagcttctgaggtg
tttcctggactaaccttgcagcaaggtcaatatccctcaccctactcctcatatggagca
gtagttggttattacattgcacatccacagtatccaggtcagcccacttatcaggtaggt
caaactataaccgtggtgatgaataccccaaacgggaaaattaccaagacgttcctggtc
actggtagttttaacgagtttagtagtgccttcgcggatatagataaggccttagttgtg
cagaatatagtgggctcacagtactatggggatcaatacagtggtttaatagtggaggca
agtagtgtgtcacaggtaaacaatgttgtaaattccatacataacgagctcggaagatca
gtaagtgttacatccgtggagcagttcatcactctcatcaataactccctatctgcggtt
aatggtcttcttttcgtagcaggcgcatcgtccttcattgtggccttcgtgggaatattg
agtactatgtttaccacagtggtggagcgaacaagggaaataggagttctgagggcaata
ggcttcaccaggagaggtataatggtgatattcgtgactgaggccatattgatgggccta
cttggaggcacagctggagtgggtgcaggggttgggatgggataccttcttaccacactt
accaattctggaggacctggggctggaagaggaagcgctgcagcgtccggtggcctcgga
atcagcgcacatattactccagtatttgaaccaacattcattgcggaagtgatacttata
acagtcattttcagtctcttcgcaggaatcatccctgcatatagggcgtccagaatcgaa
ccagctgtggcattaagatatgaagtgtag

DBGET integrated database retrieval system