KEGG   Metallosphaera sedula: Msed_1582Help
Entry
Msed_1582         CDS       T00509                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mse  Metallosphaera sedula
Pathway
mse00020  Citrate cycle (TCA cycle)
mse00640  Propanoate metabolism
mse00660  C5-Branched dibasic acid metabolism
mse00720  Carbon fixation pathways in prokaryotes
mse01100  Metabolic pathways
mse01110  Biosynthesis of secondary metabolites
mse01120  Microbial metabolism in diverse environments
mse01130  Biosynthesis of antibiotics
mse01200  Carbon metabolism
Module
mse_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mse_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mse_M00374  Dicarboxylate-hydroxybutyrate cycle
Brite
KEGG Orthology (KO) [BR:mse00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Msed_1582
   00640 Propanoate metabolism
    Msed_1582
   00660 C5-Branched dibasic acid metabolism
    Msed_1582
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Msed_1582
Enzymes [BR:mse01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Msed_1582
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 ATP-grasp CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: ABP95737
UniProt: A4YH35
Position
complement(1530193..1531206)
Genome map
AA seq 337 aa AA seqDB search
MKLYEYEGKRLFSLVNIPVPRGQVVKSPVHVQGKVVVKSQLLEGGRGKRGLVRVTEDSYG
TIQELMKEGINTFLIEEFVPHTREIYLSAMMDRETGNPMIVASPFGGINIEESKDVKTFV
IPIDRKLMRYDVDAIEKYVGYRGLGGVIEGLLRLILEYDAELAEINPLAITENGPLALDS
KVILDDNALYRHEELLKELQREKVPADSYVELEGDVGIVGNGAGLTMATMDLVKLMGGNP
ADFLDVGGGADTEKVASAVIRVGSNPKVKKIVINIFGGITRCDEVAKGIVEAYRKINKPI
YVRLTGTNEDEGKKILQSQGIRVYEDALTAIGDALRS
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaagctttacgagtatgagggaaagaggcttttttcgctcgttaacatcccagtgcct
cgcggacaggtggtgaagtcccctgttcacgttcaagggaaggtggtggttaagtcacaa
ctacttgagggcggtaggggaaagagggggcttgttagggtaactgaggacagttacggc
acgattcaagaactcatgaaggaaggtataaacacattcttgatagaggaatttgtcccg
cacaccagggaaatatacctttcagctatgatggatcgagagactgggaacccgatgata
gtggcatccccatttggtgggataaacattgaggagagtaaggacgtcaagacttttgtt
atccccatagatagaaaattaatgaggtacgatgtggatgcaatcgagaaatatgttggg
tataggggtctcggaggggtcatagaaggtttactcaggctaatcttggagtacgacgct
gaattggctgagattaatccgctcgccatcacggagaacggtcctctggctctcgactcc
aaggtaatcctagatgataacgcactgtatagacacgaagaactgttaaaggagctacag
agggagaaagttccagcggattcctacgtcgaactcgagggagacgtgggcatagtgggt
aatggcgcaggtcttacaatggcgaccatggatctcgtgaaactaatggggggaaatccg
gctgatttcctagatgtaggagggggtgcagataccgaaaaggttgcgtctgcggtgatc
agggttggaagtaaccccaaggtgaaaaagatagtgattaacattttcggtggaataact
aggtgtgatgaggtagctaaggggatagtggaggcctatcgtaagataaacaaacccatt
tacgtcaggttaactggtacgaatgaggatgaagggaagaaaatactccaaagtcaaggg
ataagagtttacgaagatgcattaaccgcaataggtgatgccctacgttcataa

DBGET integrated database retrieval system