KEGG   Metallosphaera sedula: Msed_1927
Entry
Msed_1927         CDS       T00509                                 

Definition
(GenBank) ketol-acid reductoisomerase
  KO
K00053  ketol-acid reductoisomerase [EC:1.1.1.86]
Organism
mse  Metallosphaera sedula
Pathway
mse00290  Valine, leucine and isoleucine biosynthesis
mse00770  Pantothenate and CoA biosynthesis
mse01100  Metabolic pathways
mse01110  Biosynthesis of secondary metabolites
mse01210  2-Oxocarboxylic acid metabolism
mse01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mse00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    Msed_1927
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Msed_1927
Enzymes [BR:mse01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.86  ketol-acid reductoisomerase (NADP+)
     Msed_1927
SSDB
Motif
Pfam: IlvN IlvC F420_oxidored AdoHcyase_NAD 2-Hacid_dh_C NAD_binding_2 ApbA NAD_binding_7 PDH
Other DBs
NCBI-ProteinID: ABP96067
UniProt: A4YI15
Position
complement(1873671..1874678)
AA seq 335 aa
MSHIAKIYTDKDTTLDPMKGKKIAVLGYGSQGRAWALNLRDSGLQVTVGLEREGKSWEQA
KADGFTPKKTEDAVKDADVVIFLVPDMAQRLVYRERVQPYLREGMDLVFAHGFNIHYRLI
EPPSNVDVYMVAPKGPGPIVRDFYVKGGGVPVLVAVHQNHSGKALEKALAIAKALGGTRA
GAIETTFKEETETDLIGEQTILVGGVMELMKAAFETLVEMGYQPEVAYFETINELKMIVD
LIYDKGFMGMLRAVSDTAKYGGFTVGKQVINEETRRRLREAAEKVRSGKFAEEWIEEYGR
GSPTLSKGLEEMDKSLEEQTGRRLKEIIERGRPKS
NT seq 1008 nt   +upstreamnt  +downstreamnt
gtgagtcatatagcaaagatctacacggataaggatacaactctagatcccatgaaggga
aagaagatagccgtacttggttacggtagtcaaggtagggcctgggctctgaacctcagg
gactccggccttcaggtaactgtgggtctagaaagggaaggtaaaagctgggaacaggct
aaggctgatggctttacgcctaagaaaactgaggatgcggtcaaggacgctgacgttgtc
atattcctggttccagacatggcccaaaggctggtttacagggaaagggttcagccctac
ctgagggaggggatggacctagttttcgcccacggcttcaatatccactatagactgata
gagcctcccagcaacgttgacgtatacatggttgcaccaaaggggcctggtcccatagtg
agggatttctacgtcaagggtggtggagtgccagttctggttgcagttcaccaaaaccac
tcaggcaaggcactggagaaggcattggccatagccaaggccttgggaggaactagggca
ggagccatagagaccactttcaaggaagagacggaaacggacctaattggagagcagaca
atcttagtgggaggagtaatggaactcatgaaggcggccttcgaaacgttagtggaaatg
ggctatcagccggaggttgcctacttcgagaccatcaacgaactcaagatgattgttgac
ctgatatatgacaagggcttcatgggaatgctcagggcagtttcggacacagcgaagtac
ggcggatttacagtgggtaaacaggtgataaatgaggagactaggaggagacttagggag
gcagctgaaaaggtaaggtcaggaaagttcgcagaggagtggattgaggagtacggaaga
ggaagtcccaccctgagtaaaggccttgaggaaatggataagagccttgaggagcaaacc
ggtagaaggctcaaggagatcatagagagaggaaggcctaaatcctaa

DBGET integrated database retrieval system