KEGG   Microbacterium sediminis: E3O41_00700
Entry
E3O41_00700       CDS       T06576                                 

Definition
(GenBank) NAD(P)-dependent oxidoreductase
  KO
K12466  (+)-trans-carveol dehydrogenase [EC:1.1.1.275]
Organism
msed  Microbacterium sediminis
Pathway
msed00903  Limonene and pinene degradation
msed01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:msed00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    E3O41_00700
Enzymes [BR:msed01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.275  (+)-trans-carveol dehydrogenase
     E3O41_00700
SSDB
Motif
Pfam: adh_short_C2 adh_short KR
Other DBs
NCBI-ProteinID: QBR73103
UniProt: A0A4P7FCU1
Position
143718..144551
AA seq 277 aa
MGRVEGKVALISGAARGQGRSHAIRLAQEGADIIAFDICEAIPEVPYDPATEEDLAETVR
QVEALDRRIVAEKADVRDFAQVQAVVEKGVAELGRLDIVSANAGISGAPNRSEDIPDEQF
VNMQEINLTGVWRTCKAAIPHIRAGGRGGSMILTSSDAGLFPYENISHYVAAKHGVVGLM
RTLALELAPEHIRVNSIHPTTVDTDMVQNDAIYRLFRPDLDHPTKDDFAEAATRMNALPI
PWVEAVDISNALLFLASDEARYITGVTLPVDAGAAIK
NT seq 834 nt   +upstreamnt  +downstreamnt
atggggcgtgtcgaaggaaaggtcgcgctgatcagcggcgcggcgcgcgggcaggggcgg
tcgcatgcgatccggctcgcgcaggagggcgcggacatcatcgcgttcgacatctgcgag
gccatccccgaggtgccgtacgacccggccaccgaggaggacctcgccgagacggtgcgc
caggtcgaggcgctggatcggcggatcgtggccgagaaggccgacgtgcgcgacttcgcg
caggtgcaggcggtggtcgagaagggcgtcgccgagctggggcgcctggacatcgtgtcg
gccaacgcgggcatctccggggctccgaaccgcagcgaggacatcccggacgagcagttc
gtcaacatgcaggagatcaacctcacgggcgtgtggcgcacgtgcaaggccgcgatcccg
cacatccgggcgggaggccggggcgggtcgatgatcctcacgagctccgacgcgggcctg
ttcccgtacgagaacatctcgcactacgtcgccgccaagcacggcgtcgtcgggctcatg
cgcaccctcgcgctcgagctggcgcccgagcacatccgggtcaacagcatccaccccacc
acggtcgacaccgacatggtgcagaacgacgcgatctaccgcctgttccgcccggacctc
gaccacccgaccaaggacgacttcgcggaggccgccacgcggatgaacgcgctgccgatc
ccgtgggtcgaggcggtggacatctcgaatgcgctgctgttcctcgcctcggacgaggcg
cggtacatcacgggggtcacgctgccggtggatgcgggggcggccatcaagtga

DBGET integrated database retrieval system